Bacteriorhodopsin (Hs) | Pure & Active Membrane Proteins | Products | Cube Biotech

Bacteriorhodopsin (Hs)


Active, purified Bacteriorhodopsin (Halobacterium salinarum)

Bacteriorhodopsin (BR) is a 7-transmembrane protein that acts as a light-driven proton pump in archaebacteria. Due to its covalently bound colored ligand, BR is widely used as a control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide BR of high purity, prepared as purple membrane patches from Halobacterium salinarum.
Proteins

Bacteriorhodopsin_SDS-Page; BR_SDS-Page
Figure 1: SDS-PAGE of bacterio-rhodopsin in purple membrane patches from H. salinarum.
Bacteriorhodopsin_spectrum;absorbance
Figure 2: Absorbance spectrum of bacteriorhodopsin in purple membrane patches from H. salinarum.

Protein
Bacteriorhodopsin (BR, HsBR, bacteriopsin)

UniProt / UniGene

Protein class
7-transmembrane protein

Organism
Halobacterium salinarum S9

Sequence
Full-length, wildtype sequence N-terminal signal sequence (underlined) which is mostly absent in the preparation

 
MLELLPTAVEGVSQAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTL VPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILA LVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMRPEVASTFK VLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEA PEPSAGDGAAATSD

Affinity tags
None

Size (excluding additional elements)
262 amino acids; 28,256 Da

Expression system
Halobacterium salinarum S9

Purified via
Sequential centrifugation

Buffer
Purple membrane (PM) patches in H2O, 0.02% NaN3

Purity (SDS-PAGE)
>98%, see Fig. 1

Absorbance
Extinction coefficient at 560 nm: 63,000 M-1 cm-1.

Activity
Binding of ligand all-trans retinal, covalently bound to a lysine residue. Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 560 nm = 2.3

Function
Photoreceptor protein undergoing a photocycle, Retinal protein, light-driven proton pump

Literature references
1. Kubicek J, Schlesinger R, Baeken C, Büldt G, Schäfer F, Labahn J. (2012) Controlled in meso phase crystallization--a method for the structural investigation of membrane proteins. PLoS One 7(4):e35458. doi: 10.1371/journal.pone.0035458. Epub 2012 Apr 19.
2. Zscherp C, Schlesinger R, Heberle J. (2001) Time-resolved FT-IR spectroscopic investigation of the pH-dependent proton transfer reactions in the E194Q mutant of bacteriorhodopsin. Biochem Biophys Res Commun. Apr 27;283(1):57-63.
Close window
Bacteriorhodopsin (Hs)

Active, purified Bacteriorhodopsin (Halobacterium salinarum)

Bacteriorhodopsin (BR) is a 7-transmembrane protein that acts as a light-driven proton pump in archaebacteria. Due to its covalently bound colored ligand, BR is widely used as a control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide BR of high purity, prepared as purple membrane patches from Halobacterium salinarum.
Proteins

Bacteriorhodopsin_SDS-Page; BR_SDS-Page
Figure 1: SDS-PAGE of bacterio-rhodopsin in purple membrane patches from H. salinarum.
Bacteriorhodopsin_spectrum;absorbance
Figure 2: Absorbance spectrum of bacteriorhodopsin in purple membrane patches from H. salinarum.

Protein
Bacteriorhodopsin (BR, HsBR, bacteriopsin)

UniProt / UniGene

Protein class
7-transmembrane protein

Organism
Halobacterium salinarum S9

Sequence
Full-length, wildtype sequence N-terminal signal sequence (underlined) which is mostly absent in the preparation

 
MLELLPTAVEGVSQAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTL VPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILA LVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMRPEVASTFK VLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEA PEPSAGDGAAATSD

Affinity tags
None

Size (excluding additional elements)
262 amino acids; 28,256 Da

Expression system
Halobacterium salinarum S9

Purified via
Sequential centrifugation

Buffer
Purple membrane (PM) patches in H2O, 0.02% NaN3

Purity (SDS-PAGE)
>98%, see Fig. 1

Absorbance
Extinction coefficient at 560 nm: 63,000 M-1 cm-1.

Activity
Binding of ligand all-trans retinal, covalently bound to a lysine residue. Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 560 nm = 2.3

Function
Photoreceptor protein undergoing a photocycle, Retinal protein, light-driven proton pump

Literature references
1. Kubicek J, Schlesinger R, Baeken C, Büldt G, Schäfer F, Labahn J. (2012) Controlled in meso phase crystallization--a method for the structural investigation of membrane proteins. PLoS One 7(4):e35458. doi: 10.1371/journal.pone.0035458. Epub 2012 Apr 19.
2. Zscherp C, Schlesinger R, Heberle J. (2001) Time-resolved FT-IR spectroscopic investigation of the pH-dependent proton transfer reactions in the E194Q mutant of bacteriorhodopsin. Biochem Biophys Res Commun. Apr 27;283(1):57-63.
Top seller
Bacteriorhodopsin (Hs)
No results were found for the filter!
Hs_Bacteriorhodopsin (500 µg) Hs_Bacteriorhodopsin (500 µg)
Active, purified purple membrane patches from Halobacterium salinarium. 5x 100 microgram in solution. Shipped on dry ice - additional freight cost may apply.
Article number: 28903
Sales price: €375.00 *
Viewed