NTSR1


Proteins
NTSR1, a human GPCR binding the neurotransmitter neurotensin, is our latest addition to our portfolio of purified GPCRs, which also includes GLP1 receptor 1, G-protein coupled bile receptor 1 (TGR5), and mu-opioid receptor 1, reconstituted in nanodisc.
The protein is available off-the shelf, ready for ligand binding studies, crystallization, and other biochemical/biophysical experiments.

 

Features

Protein NTSR1 (Neurotensin receptor type 1)
Alternative names High-affinity levocabastine-insensitive neurotensin receptor NTRH
UniProt number P30989
Protein class GPCR
Organism Human (Homo sapiens)
Sequence

Full-length, wildtype sequence N-terminal HA tag (underlined), 6x His-tag (red), spacer (gray), Rho1D4 tag (green)


MKTIIALSYIFCLVFAHHHHHHRLNSSAPGT PGTPAADPFQ RAQAGLEEAL LAPGFGNASG NASERVLAAP SSELDVNTDI YSKVLVTAVY LALFVVGTVG NTVTAFTLAR KKSLQSLQST VHYHLGSLAL SDLLTLLLAM PVELYNFIWV HHPWAFGDAG CRGYYFLRDA CTYATALNVA SLSVERYLAI CHPFKAKTLM SRSRTKKFIS AIWLASALLA VPMLFTMGEQ NRSADGQHAG GLVCTPTIHT ATVKVVIQVN TFMSFIFPMV VISVLNTIIA NKLTVMVRQA AEQGQVCTVG GEHSTFSMAI EPGRVQALRH GVRVLRAVVI AFVVCWLPYH VRRLMFCYIS DEQWTPFLYD FYHYFYMVTN ALFYVSSTIN PILYNLVSAN FRHIFLATLA CLCPVWRRRR KRPAFSRKAD SVSSNHTLSS NATRETLYGSSGTETSQVAPA

Affinity tags N-terminal His / C-terminal Rho1D4
Size (excluding additional elements) 436 amino acids, 48,13 kDa
Expression system Sf9 (baculovirus)
Purified via Rho1D4 affinity chromatography, size exclusion chromatography
Buffer 50 mM HEPES, pH 8.0; 200 mM NaCl; 10% Glycerol; 0.1% n-Decyl-beta-maltoside; 0.01% cholesterolhemisuccinate; 0.01% CHAPSO
Purity (SDS-PAGE) >95% as determined by SDS-PAGE
Homogeneity Size exclusion chromatography
Activity LNot determined
Function Receptor for neurotensin. Involved in hypotension, hyperglycemia, hypothermia, antinociception, and regulation of intestinal motility and secretion.
Proteins
NTSR1, a human GPCR binding the neurotransmitter neurotensin, is our latest addition to our portfolio of purified GPCRs, which also includes GLP1 receptor 1, G-protein coupled bile receptor 1 (TGR5), and mu-opioid receptor 1, reconstituted in nanodisc.
The protein is available off-the shelf, ready for ligand binding studies, crystallization, and other biochemical/biophysical experiments.

 

Features

Protein NTSR1 (Neurotensin receptor type 1)
Alternative names High-affinity levocabastine-insensitive neurotensin receptor NTRH
UniProt number P30989
Protein class GPCR
Organism Human (Homo sapiens)
Sequence

Full-length, wildtype sequence N-terminal HA tag (underlined), 6x His-tag (red), spacer (gray), Rho1D4 tag (green)


MKTIIALSYIFCLVFAHHHHHHRLNSSAPGT PGTPAADPFQ RAQAGLEEAL LAPGFGNASG NASERVLAAP SSELDVNTDI YSKVLVTAVY LALFVVGTVG NTVTAFTLAR KKSLQSLQST VHYHLGSLAL SDLLTLLLAM PVELYNFIWV HHPWAFGDAG CRGYYFLRDA CTYATALNVA SLSVERYLAI CHPFKAKTLM SRSRTKKFIS AIWLASALLA VPMLFTMGEQ NRSADGQHAG GLVCTPTIHT ATVKVVIQVN TFMSFIFPMV VISVLNTIIA NKLTVMVRQA AEQGQVCTVG GEHSTFSMAI EPGRVQALRH GVRVLRAVVI AFVVCWLPYH VRRLMFCYIS DEQWTPFLYD FYHYFYMVTN ALFYVSSTIN PILYNLVSAN FRHIFLATLA CLCPVWRRRR KRPAFSRKAD SVSSNHTLSS NATRETLYGSSGTETSQVAPA

Affinity tags N-terminal His / C-terminal Rho1D4
Size (excluding additional elements) 436 amino acids, 48,13 kDa
Expression system Sf9 (baculovirus)
Purified via Rho1D4 affinity chromatography, size exclusion chromatography
Buffer 50 mM HEPES, pH 8.0; 200 mM NaCl; 10% Glycerol; 0.1% n-Decyl-beta-maltoside; 0.01% cholesterolhemisuccinate; 0.01% CHAPSO
Purity (SDS-PAGE) >95% as determined by SDS-PAGE
Homogeneity Size exclusion chromatography
Activity LNot determined
Function Receptor for neurotensin. Involved in hypotension, hyperglycemia, hypothermia, antinociception, and regulation of intestinal motility and secretion.
Top seller
NTSR1 protein NTSR1 protein
Article number: 28301
NTSR1
No results were found for the filter!
NTSR1 protein NTSR1 protein
Purified membrane protein preparation. 10 microgram in solution. Shipped on dry ice - additional freight cost may apply.
Article number: 28301
Sales price: From €916.00 *
Viewed