Active, purified Sensory rhodopsin-1 (Halobacterium salinarum)
Sensory rhodopsin-1 (SR-1) is a 7-transmembrane protein that acts as a phototaxis receptor in archaebacteria. Due to its covalently bound colored ligand, SR-1 is ideal for use as a control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide SR-1 of high purity, purified from E.coli as a his-tagged protein.
Figure 1: SDS-PAGE of sensory rhodopsin-1 from H. salinarum.
Figure 2: Absorbance spectrum of sensory rhodopsin-1 from H. salinarum.
Protein
Sensory rhodopsin-1 (SR-1, HsSRI)
Protein class
7-transmembrane protein
Organism
Halobacterium salinarum S9
Sequence
wild-type sequence 1-234 aa (lacking 15 aa at the C-terminus), 10x His-tag (red)
MDAVATAYLGGAVALIVGVAFVWLLYRSLDGSPHQSALAPLAIIPVFAGLSYVGMAYDIGTV IVNGNQIVGLRYIDWLVTTPILVGYVGYAAGASRRSIIGVMVADALMIAVGAGAVVTDGTLK WALFGVSSIFHLSLFAYLYVIFPRVVPDVPEQIGLFNLLKNHIGLLWLAYPLVWLFGPAGIGEA TAAGVALTYVFLDVLAKVPYVYFFYARRRVFMHSESHHHHHHHHHH
Affinity tags
His-tag (C-terminus)
Size
234 amino acids; 25,423 Da
Purity (SDS-PAGE)
>98%, see Fig. 1
Absorbance
Extinction coefficient at 560 nm: 63,000 M-1 cm-1.
Absorbance
Extinction coefficient at 590 nm: 54,000 M-1 cm-1.
Activity
Binding of ligand all-trans retinal, covalently bound to a lysine residue. Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 590 nm = 1.7
Function
Photoreceptor protein undergoing a photocycle, Retinal protein, phototaxis receptor
Literature references
1. Radu I, Budyak IL, Hoomann T, Kim YJ, Engelhard M, Labahn J, Büldt G, Heberle J, Schlesinger R. (2010)
Signal relay from sensory rhodopsin I to the cognate transducer HtrI: assessing the critical change in hydrogen-bonding between Tyr-210 and Asn-53. Biophys Chem. Aug;150(1-3):23-8. doi: 10.1016/j.bpc.2010.02.017. Epub 2010 Mar 2.
2. Schmies G, Chizhov I, Engelhard M. (2000)
Functional expression of His-tagged sensory rhodopsin I in Escherichia coli. FEBS Lett. Jan 21;466(1):67-9.
Sensory rhodopsin-1_Hs (100 ug)