Sensory rhodopsin-2 (Hs) | Pure & Active Membrane Proteins | Products | Cube Biotech

Sensory rhodopsin-2 (Hs)


Active, purified Sensory rhodopsin-2 (Halobacterium salinarum)

Sensory rhodopsin-2 (SR-2) is a 7-transmembrane protein that acts as a phototaxis receptor in archaebacteria. Due to its covalently bound colored ligand, SR-2 is ideal for use as a control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide SR-2 of high purity, purified from E. coli as a his-tagged protein.
Proteins

Sensory_rhodpsin2_SDS-Page
Figure 1: SDS-PAGE of sensory rhodopsin-2 from H. salinarum.
Sensory_rhodpsin2_Absorbance
Figure 2: Absorbance spectrum of sensory rhodopsin-2 from H. salinarum.

Protein
Sensory rhodopsin-2 (SR-2, NpSRII)

UniProt / UniGene

Protein class
7-transmembrane protein

Organism
Halobacterium salinarum S9

Sequence
wild-type sequence, full-length, 6x His-tag (red)

 

MALTTWFWVGAVGMLAGTVLPIRDCIRHPSHRRYDLVLAGITGLAAIAYTTMGLGITATTVG

DRTVYLARYIDWLVTTPLIVLYLAMLARPGHRTSAWLLAADVFVIAAGIAAALTTGVQRWLF

FAVGAAGYAALLYGLLGTLPRALGDDPRVRSLFVTLRNITVVLWTLYPVVWLLSPAGIGILQ

TEMYTIVVVYLDFISKVAFVAFAVLGADAVSRLVAADAAAPATAEPTPDGDHHHHHH


Affinity tags
His-tag (C-terminus)

Size
243 amino acids; 26,103 Da

Expression system
E.coli


Buffer
4 M NaCl, 50 mM MES pH 6.0, 0.03% dodecyl maltoside (DDM)

Purity (SDS-PAGE)
>98%, see Fig. 1

Absorbance
Extinction coefficient at 497 nm: 48,000 M-1 cm-1.

Absorbance
Extinction coefficient at 590 nm: 54,000 M-1 cm-1.

Activity
Binding of ligand all-trans retinal, covalently bound to a lysine residue. Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 497 nm = 1.7(additional vibronic bands at 460 nm and 420 nm)

Function
Photoreceptor protein undergoing a photocycle, Retinal protein, photophobic phototaxis receptor

Literature references
1. Mironova OS, Efremov RG, Person B, Heberle J, Budyak IL, Büldt G, Schlesinger R. (2005) Functional characterization of sensory rhodopsin II from Halobacterium salinarum expressed in Escherichia coli. FEBS Lett. Jun 6;579(14):3147-51
Close window
Sensory rhodopsin-2 (Hs)

Active, purified Sensory rhodopsin-2 (Halobacterium salinarum)

Sensory rhodopsin-2 (SR-2) is a 7-transmembrane protein that acts as a phototaxis receptor in archaebacteria. Due to its covalently bound colored ligand, SR-2 is ideal for use as a control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide SR-2 of high purity, purified from E. coli as a his-tagged protein.
Proteins

Sensory_rhodpsin2_SDS-Page
Figure 1: SDS-PAGE of sensory rhodopsin-2 from H. salinarum.
Sensory_rhodpsin2_Absorbance
Figure 2: Absorbance spectrum of sensory rhodopsin-2 from H. salinarum.

Protein
Sensory rhodopsin-2 (SR-2, NpSRII)

UniProt / UniGene

Protein class
7-transmembrane protein

Organism
Halobacterium salinarum S9

Sequence
wild-type sequence, full-length, 6x His-tag (red)

 

MALTTWFWVGAVGMLAGTVLPIRDCIRHPSHRRYDLVLAGITGLAAIAYTTMGLGITATTVG

DRTVYLARYIDWLVTTPLIVLYLAMLARPGHRTSAWLLAADVFVIAAGIAAALTTGVQRWLF

FAVGAAGYAALLYGLLGTLPRALGDDPRVRSLFVTLRNITVVLWTLYPVVWLLSPAGIGILQ

TEMYTIVVVYLDFISKVAFVAFAVLGADAVSRLVAADAAAPATAEPTPDGDHHHHHH


Affinity tags
His-tag (C-terminus)

Size
243 amino acids; 26,103 Da

Expression system
E.coli


Buffer
4 M NaCl, 50 mM MES pH 6.0, 0.03% dodecyl maltoside (DDM)

Purity (SDS-PAGE)
>98%, see Fig. 1

Absorbance
Extinction coefficient at 497 nm: 48,000 M-1 cm-1.

Absorbance
Extinction coefficient at 590 nm: 54,000 M-1 cm-1.

Activity
Binding of ligand all-trans retinal, covalently bound to a lysine residue. Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 497 nm = 1.7(additional vibronic bands at 460 nm and 420 nm)

Function
Photoreceptor protein undergoing a photocycle, Retinal protein, photophobic phototaxis receptor

Literature references
1. Mironova OS, Efremov RG, Person B, Heberle J, Budyak IL, Büldt G, Schlesinger R. (2005) Functional characterization of sensory rhodopsin II from Halobacterium salinarum expressed in Escherichia coli. FEBS Lett. Jun 6;579(14):3147-51
Top seller
Sensory rhodopsin-2 (Hs)
No results were found for the filter!
Sensory rhodopsin-2_Hs (100 ug) Sensory rhodopsin-2_Hs (100 ug)
Active, purified his-tagged membrane protein from Halobacterium salinarium. 100 microgram in solution. Shipped on dry ice - additional freight cost may apply.
Article number: 28921
Sales price: €300.00 *
Viewed