Sensory rhodopsin-2 (Np) | Pure & Active Membrane Proteins | Products | Cube Biotech

Sensory rhodopsin-2 (Np)


Active, purified Sensory rhodopsin-2 (Natronomonas pharaonis)

Sensory rhodopsin-2 (SR-2) is a 7-transmembrane protein that acts as a phototaxis receptor in archaebacteria. Due to its covalently bound colored ligand, SR-2 is ideal for use as a control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide SR-2 of high purity, purified from E. coli as a his-tagged protein.
Proteins

SDS-Page; Sensory Rhodopsin2
Figure 1: SDS-PAGE of sensory rhodopsin-2 from N. pharaonis.
Absorbance Sensory Rhodopsin2
Figure 2: Absorbance spectrum of sensory rhodopsin-2 from N. pharaonis.

Protein
Sensory rhodopsin-2 (SR-2, NpSRII)

UniProt / UniGene

Protein class
7-transmembrane protein

Organism
Natronomonas pharaonis (Natronobacterium pharaonis)

Sequence
wild-type sequence, full-length, 7x His-tag (red)

 
MVGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGW VPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERY ALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLLGPPGVAL LTPTVDVALIVYLDLVTKVGFGFIALDAAATLRAEHGESLAGVDTDAPAVADHHHHHHH

Affinity tags
His-tag (C-terminus)

Size
246 amino acids; 26,315 Da

Expression system
E.coli


Buffer
300 mM NaCl, 50 mM MES pH 6.0, 0.03% dodecyl maltoside (DDM)

Purity (SDS-PAGE)
>98%, see Fig. 1

Absorbance
Extinction coefficient at 500 nm: 45,500 M-1 cm-1.

Absorbance
Extinction coefficient at 590 nm: 54,000 M-1 cm-1.

Activity
Binding of ligand all-trans retinal, covalently bound to a lysine residue. Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 500 nm = 2.8

Function
Photoreceptor protein undergoing a photocycle, Retinal protein, photophobic phototaxis receptor

Literature references
1. Gordeliy VI, Labahn J, Moukhametzianov R, Efremov R, Granzin J, Schlesinger R, Büldt G, Savopol T, Scheidig AJ, Klare JP, Engelhard M. (2002) Molecular basis of transmembrane signalling by sensory rhodopsin II-transducer complex.Nature. Oct 3;419(6906):484-7.
2. Orekhov P, Bothe A, Steinhoff HJ, Shaitan KV, Raunser S, Fotiadis D, Schlesinger R, Klare JP, Engelhard M. (2017) SensoryRhodopsin I and Sensory Rhodopsin II Form Trimers of Dimers in Complex with their Cognate Transducers. Photochem Photobiol. 2017 May;93(3):796-804. doi: 10.1111/php.12763.
Close window
Sensory rhodopsin-2 (Np)

Active, purified Sensory rhodopsin-2 (Natronomonas pharaonis)

Sensory rhodopsin-2 (SR-2) is a 7-transmembrane protein that acts as a phototaxis receptor in archaebacteria. Due to its covalently bound colored ligand, SR-2 is ideal for use as a control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide SR-2 of high purity, purified from E. coli as a his-tagged protein.
Proteins

SDS-Page; Sensory Rhodopsin2
Figure 1: SDS-PAGE of sensory rhodopsin-2 from N. pharaonis.
Absorbance Sensory Rhodopsin2
Figure 2: Absorbance spectrum of sensory rhodopsin-2 from N. pharaonis.

Protein
Sensory rhodopsin-2 (SR-2, NpSRII)

UniProt / UniGene

Protein class
7-transmembrane protein

Organism
Natronomonas pharaonis (Natronobacterium pharaonis)

Sequence
wild-type sequence, full-length, 7x His-tag (red)

 
MVGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGW VPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERY ALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLLGPPGVAL LTPTVDVALIVYLDLVTKVGFGFIALDAAATLRAEHGESLAGVDTDAPAVADHHHHHHH

Affinity tags
His-tag (C-terminus)

Size
246 amino acids; 26,315 Da

Expression system
E.coli


Buffer
300 mM NaCl, 50 mM MES pH 6.0, 0.03% dodecyl maltoside (DDM)

Purity (SDS-PAGE)
>98%, see Fig. 1

Absorbance
Extinction coefficient at 500 nm: 45,500 M-1 cm-1.

Absorbance
Extinction coefficient at 590 nm: 54,000 M-1 cm-1.

Activity
Binding of ligand all-trans retinal, covalently bound to a lysine residue. Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 500 nm = 2.8

Function
Photoreceptor protein undergoing a photocycle, Retinal protein, photophobic phototaxis receptor

Literature references
1. Gordeliy VI, Labahn J, Moukhametzianov R, Efremov R, Granzin J, Schlesinger R, Büldt G, Savopol T, Scheidig AJ, Klare JP, Engelhard M. (2002) Molecular basis of transmembrane signalling by sensory rhodopsin II-transducer complex.Nature. Oct 3;419(6906):484-7.
2. Orekhov P, Bothe A, Steinhoff HJ, Shaitan KV, Raunser S, Fotiadis D, Schlesinger R, Klare JP, Engelhard M. (2017) SensoryRhodopsin I and Sensory Rhodopsin II Form Trimers of Dimers in Complex with their Cognate Transducers. Photochem Photobiol. 2017 May;93(3):796-804. doi: 10.1111/php.12763.
Top seller
Sensory rhodopsin-2 (Np)
No results were found for the filter!
Sensory rhodopsin-2 (N. pharaonis ,100 µg) Sensory rhodopsin-2 (N. pharaonis ,100 µg)
Sensory rhodopsin-2 from Natronomonas pharaonis. Ideal for use as a control membrane protein. Ready to order and use. 100 µg
Article number: 28931
Sales price: €300.00 *
Viewed