Purified Enhanced Green Fluorescent Protein (eGFP)

Green Fluorescent Protein is a natural, autofluorescent protein from the jellyfish Aequorea victoria that is frequently used as a control protein in method development and calibration.

 

Enhanced GFP (eGFP) is a mutated GFP with enhanced fluorescence signal and a slightly shifted excitation spectrum. Cube Biotech offers three variants of eGFP with His, GST, Rho1D4, and DYKDDDDK (also known as FLAG) tags.

Please contact us for bulk inquiries, academic projects or collaboration ideas.

 

Expression system E. coli
Purification affinity chromatography
Provided as lyophilized from 10 mM Tris-HCl, pH 4.0
Excitation maximum 488 nm
Emission maximum 509 nm
 

GFP protein with His, GST, Rho1D4, and DYKDDDDK (FLAG) tag

 
 
 
 
 
 
 
 
Fig. 1: Size and purity of three eGFP variants assessed by SDS-PAGE.
 
 

  Protein

Protein size

Protein sequence

   
Red: His-tag, Grey Underlined: Spacer, Blue: GST tag, Light Green:
Rho1D4 tag, Dark Green: DYKDDDDK tag, Purple: Thrombin site,
Black: eGFP, Underlined: HRV 3C (PreScission) site

 

  His-eGFP

26 kDa

MKHHHHHHHMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK

FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKD

DGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNGHNVYITADKQKN

GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKR

DHMVLLEFVTAAGITHGMDELYKStop

  GST-eGFP-Rho1D4

55.4 kDa

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYY

IDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETL

KVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKL

VCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLEVLFQGP

MRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW

PTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFE

GDTLVNRIELKGIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDG

SVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHG

MDELYKGSSGTETSQVAPAStop

  GST-eGFP-DYKDDDDK

55.5 kDa

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYY

IDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETL

KVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKL

VCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLEVLFQGP

MRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW

PTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFE

GDTLVNRIELKGIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDG

SVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHG

MDELYKGSSGDYKDDDDKStop

 

Select Country
Results 1 - 6 of 6

Green fluorescent protein (eGFP)

No image set
Current Stock Level

eGFP protein, His-tag (50 ug)

Sales price: 186,00 €

Product details

No image set
Current Stock Level

eGFP protein, His-tag (250 ug)

Sales price: 580,00 €

Product details

No image set
Current Stock Level
No image set
Current Stock Level
No image set
Current Stock Level
No image set
Current Stock Level