Active, purified Bacteriorhodopsin (Halobacterium salinarum)

Bacteriorhodopsin (BR) is a 7-transmembrane protein that acts as a light-driven proton pump in archaebacteria. Due to its covalently bound colored ligand, BR is widely used as a  control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide BR of high purity, prepared as purple membrane patches from Halobacterium salinarum.

Please contact us for bulk inquiries, academic projects or collaboration ideas.

 

Active Membrane Proteins


   

Figure 1: SDS-PAGE of bacterio-
rhodopsin in purple membrane patches from H. salinarum.
Figure 2: Absorbance spectrum of bacteriorhodopsin in purple membrane patches from H. salinarum.

 

Protein

Bacteriorhodopsin (BR, HsBR, bacteriopsin)

UniProt / UniGene

P02945

 

Protein class

7-transmembrane protein

Organism

Halobacterium salinarum S9

Sequence

Full-length, wildtype sequence
N-terminal signal sequence (underlined) which is mostly absent in the preparation
 

MLELLPTAVEGVSQAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTL

VPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILA

LVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMRPEVASTFK

VLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEA

PEPSAGDGAAATSD

Affinity tags

None
Size
262 amino acids; 28,256 Da

Expression system

Halobacterium salinarum S9

Purified via

Sequential centrifugation

Buffer

Purple membrane (PM) patches in H2O, 0.02% NaN3

Purity (SDS-PAGE)

>98%, see Fig. 1
Absorbance Extinction coefficient at 560 nm: 63,000 M-1 cm-1.

Activity

Binding of ligand all-trans retinal, covalently bound to a lysine residue.

Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 560 nm = 2.3

Function

Photoreceptor protein undergoing a photocycle, Retinal protein, light-driven proton pump
Literature  references:
1. Kubicek J, Schlesinger R, Baeken C, Büldt G, Schäfer F, Labahn J. (2012)
Controlled in meso phase crystallization--a method for the structural investigation of membrane proteins.  PLoS One 7(4):e35458. doi: 10.1371/journal.pone.0035458. Epub 2012 Apr 19.
2. Zscherp C, Schlesinger R, Heberle J. (2001) Time-resolved FT-IR spectroscopic investigation of the pH-dependent proton transfer reactions in the E194Q mutant of bacteriorhodopsin. Biochem Biophys Res Commun. Apr 27;283(1):57-63.

Select Country
Results 1 - 1 of 1

Bacteriorhodopsin (Hs)

28903_100px
Current Stock Level

Bacteriorhodopsin_Hs (500 ug)

Sales price: 375,00 €

Product details