Active, purified Channelrhodopsin 1 (Chloromonas augustae)

Channelrhodopsin 1 is a 7-transmembrane protein that acts as a light-driven cation channel in eukaryotic green algae. Due to its covalently bound colored ligand, it is ideal for use as a  control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide channelrhodopsin 1 of high purity, purified from yeast as a his-tagged protein.

Please contact us for bulk inquiries, academic projects or collaboration ideas.

 

Active Membrane Proteins


   

Figure 1: SDS-PAGE of channelrhodopsin 1
from C. augustae.
Figure 2: Absorbance spectrum of channelrhodopsin 1
from C. augustae.

 

Protein

Channelrhodopsin 1 (CaChR1)

UniProt / UniGene

G8HKA1

Protein class

7-transmembrane protein

Organism

Chloromonas augustae (Chlamydomonas augustae)

Sequence

wild-type sequence, N-terminal membrane-spanning domain (362 of 715 aa), 10x His-tag (red)
 

MDTLAWVARELLSTAHDATPATATPSTDHSTPSTDHGSGETFNVTITIGGGHHGGHAGPVDN

SIVIGGIDGWIAIPAGDCYCAGWYVSHGSSFEATFAHVCQWSIFAVCILSLLWYAWQYWKAT

CGWEEVYVCCIELVFICFELYHEFDSPCSLYLSTANIVNWLRYSEWLLCCPVILIHLSNVTGLS

DDYGRRTMGLLVSDIATIVFGITAAMLVSWPKIIFYLLGFTMCCYTFYLAAKVLIESFHQVPK

GICRHLVKAMAITYYVGWSFFPLIFLFGQSGFKKISPYADVIASSFGDLISKNMFGLLGHFLRV

KIHEHILKHGDIRKTTHLRIAGEEKEVETFVEEEDEDHHHHHHHHHH

Affinity tags

His-tag (C-terminus)
Size
362 amino acids; 40,661 Da

Expression system

Pichia pastoris (yeast)

Purified via

PureCube Ni-NTA Agarose, size exclusion chromatography

Buffer

100 mM NaCl, 20 mM HEPES pH 7.4, 0.03% dodecyl maltoside (DDM)

Purity (SDS-PAGE)

>98%, see Fig. 1
Absorbance Extinction coefficient at 518 nm: 36,000 M-1 cm-1.

Activity

Binding of ligand all-trans retinal, covalently bound to a lysine residue.

Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 518 nm = 2.2

(additional vibronic band at 480 nm)

Function

Photoreceptor protein undergoing a photocycle, Retinal protein, light-driven cation channel
Literature  references:
1. Hou SY, Govorunova EG, Ntefidou M, Lane CE, Spudich EN, Sineshchekov OA, Spudich JL. (2012) Diversity of Chlamydomonas channelrhodopsins. Photochem Photobiol. Jan-Feb;88(1):119-28. doi: 10.1111/j.1751-1097.2011.01027.x. Epub 2011 Nov 29.
2. MudersV, Kerruth S, Lórenz-Fonfría VA, Bamann C, Heberle J, Schlesinger R. (2014)
Resonance Raman and FTIR spectroscopic characterization of the closed and open states of channelrhodopsin-1. FEBS Lett. Jun 27;588(14):2301-6. doi: 10.1016/j.febslet.2014.05.019. Epub 2014 May 21.

Select Country
Results 1 - 1 of 1

Channelrhodopsin 1 (Ca)

28941_100px
Current Stock Level

Channelrhodopsin 1_Ca (100 ug)

Sales price: 600,00 €

Product details