Active, purified GLP1R (Glucagon-like peptide 1 receptor)

Membrane proteins are the most pharmaceutically relevant protein class. At the same time, it is very difficult to obtain them in pure, active form. Cube Biotech's protein experts have worked hard to produce human GPCRs in sufficient quality that we can now offer to the community.

We offer active, purified GLP1R,  a human GPCR involved in insuline production and appetite regulation.

The protein is available off-the shelf, ready for ligand binding studies, crystallization, and other biochemical/biophysical experiments.

 

Please contact us for bulk inquiries, academic projects or collaboration ideas.

 

 

Active Membrane Proteins
Fig. 1: Size and purity of GLP1R assessed by SDS-PAGE and size exclusion chromatography. Note: GLP1R is always detected as a double band in SDS-PAGE.
 
 

Fig. 2: Surface plasmon resonance measurement of GLP1R-exendin interaction. Using a 1:1 binding model, the dissociation constant (Kd) value was determined to 6.11x10e-7 M.

 

 

 

 

 
 
   
   

Protein

GLP1R (Glucagon-like peptide 1 receptor)

Alternative names

GLP1-receptor

UniProt number

P43220

Protein class

GPCR, class B

Organism

Human (Homo sapiens)

Sequence

Full-length, wildtype sequence
N-terminal HA tag (underlined), C-terminal 10x His-tag in red,
HRV 3C protease site in blue, spacer in bold grey, Rho1D4 tag in bold green
 
MKTIIALSYIFCLVFARPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCP
WYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAIL
LGFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAANYYWLLV
EGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFVRVI
CIVVSKLKANLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQL
EFRKSWERWRLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCSGGHHHHHHHHHHLEVLFQGPGSSG
TETSQVAPA

Affinity tags

His / Rho1D4 (both C-terminal)
Size (excluding
additional elements)
489 (463) amino acids
56,170 (53,026) Da

Expression system

Sf9 (baculovirus)

Purified via

Protein-specific affinity matrix using immobilized agonist ligand, size exclusion chromatography

Buffer

20 mM HEPES pH 7.5, 150 mM NaCl, 10% Glycerol, 0.02% Foscholine-12

Purity (SDS-PAGE)

>98% as determined by SDS-PAGE

Homogeneity

Size exclusion chromatography

Activity

Ligand binding measured by SPR using the agonist ligand exendin-4 at 10°C. Using a 1:1 binding model, the dissociation constant (Kd) was determined to 6.11x10e-7 M, which is in accordance with published values.

Function

Receptor for glucagon-like peptide 1. Expressed in pancreas, brain, heart, kidney and the GI tract. Involved in insuline secretion and appetite regulation.
Literature  references:
1. Hwang JI et al. Molecular evolution of GPCRs: GLP1/GLP1 receptors. J. Mol. Endocrinol. (2014) 52 (3) 15-27.
2. Sisley S. et al. Neuronal GLP1R mediates liraglutide's anorectic but not glucose-lowering effect. (2014) J. Clin. inv. 124(6)2456-2463.

Neuronal GLP1R mediates liraglutide's anorectic but not glucose-lowering effect.

Neuronal GLP1R mediates liraglutide's anorectic but not glucose-lowering effect.

Select Country
Results 1 - 1 of 1

GLP1 Receptor

No image set
Current Stock Level

GLP1R protein (10 ug)

Sales price: 969,00 €

Product details