Purified MC4R (Melanocortin 4 Receptor)

MC4R, a human GPCR playing a central role in energy homeostasis, is our latest addition to our portfolio of purified GPCRs, which also includes GLP1 receptor 1, G-protein coupled bile receptor 1 (TGR5), neurotensin receptor 1, and mu-opioid receptor 1, reconstituted in nanodisc.

 

The protein is available off-the shelf, ready for ligand binding studies, crystallization, and other biochemical/biophysical experiments.

Please contact us for bulk inquiries, academic projects or collaboration ideas.

 

Active Membrane Proteins

 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
Fig. 1: Size and purity of MC4R assessed by SDS-PAGE and Western Blot, using a Rho1D4 antibody.
 
 

Protein

MC4R (Melanocortin 4 Receptor)

UniProt number P32245
Protein Class GPCR
Organism human
Sequence

Full-length, wildtype sequence

TEV cleavage site (underlined), spacer (gray), Rho1D4 tag (green)

 

MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLL

ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN

IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVGIIISCIWAACTVS

GILFIIYSDSSAVIICLITMFFTMLALMASLYVHMFLMARLHIKRIAVLPGTGAIRQGAN

MKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPL

IYALRSQELRKTFKEIICCYPLGGLCDLSSRYENLYFQGGSSGTETSQVAPA

Affinity tags Rho1D4 tag, C-terminal
Size (excluding affinity sequence) 36.4 kDa
Expression system Insect cells / baculovirus
Purified via Rho1D4 affinity chromatography, size exclusion chromatography (SEC)
Buffer 20 mM Hepes, pH 7.5; 100 mM NaCl; 2 mM EDTA; 0,1% decylmaltoside
Purity (SDS-PAGE) >95%, as determined by SDS-PAGE, SEC and Western Blot
Activity Not determined
Function Receptor specific to the heptapeptide core common to adrenocorticotropic hormone and alpha-, beta-, and gamma-MSH. Plays a central role in energy homeostasis and somatic growth. This receptor is mediated by G proteins that stimulate adenylate cyclase (cAMP).

Select Country
Results 1 - 1 of 1

MC4R

No image set
Current Stock Level

MC4R protein (10 ug)

Sales price: 898,00 €

Product details