Purified NTSR1 (Neurotensin receptor type 1)

NTSR1, a human GPCR binding the neurotransmitter neurotensin, is our latest addition to our portfolio of purified GPCRs, which also includes GLP1 receptor 1, G-protein coupled bile receptor 1 (TGR5), and mu-opioid receptor 1, reconstituted in nanodisc.

 

The protein is available off-the shelf, ready for ligand binding studies, crystallization, and other biochemical/biophysical experiments.

Please contact us for bulk inquiries, academic projects or collaboration ideas.

 

Active Membrane Proteins

 

 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
Fig. 1: Size and purity of NTSR1 assessed by SDS-PAGE and Western Blot, using a Rho1D4 antibody.
 
 

 

 

 

Protein

NTSR1 (Neurotensin receptor type 1)

Alternative names

High-affinity levocabastine-insensitive neurotensin receptor
 
NTRH

UniProt number

P30989

Protein class

GPCR

Organism

Human (Homo sapiens)

Sequence

Full-length, wildtype sequence
N-terminal HA tag (underlined), 6x His-tag (red), spacer (gray), Rho1D4 tag (green)
 
MKTIIALSYIFCLVFAHHHHHHRLNSSAPGT PGTPAADPFQ RAQAGLEEAL LAPGFGNASG NASERVLAAP SSELDVNTDI YSKVLVTAVY LALFVVGTVG NTVTAFTLAR KKSLQSLQST VHYHLGSLAL SDLLTLLLAM PVELYNFIWV HHPWAFGDAG CRGYYFLRDA CTYATALNVA SLSVERYLAI CHPFKAKTLM SRSRTKKFIS AIWLASALLA VPMLFTMGEQ NRSADGQHAG GLVCTPTIHT ATVKVVIQVN TFMSFIFPMV VISVLNTIIA NKLTVMVRQA AEQGQVCTVG GEHSTFSMAI EPGRVQALRH GVRVLRAVVI AFVVCWLPYH VRRLMFCYIS DEQWTPFLYD FYHYFYMVTN ALFYVSSTIN PILYNLVSAN FRHIFLATLA CLCPVWRRRR KRPAFSRKAD SVSSNHTLSS NATRETLYGSSGTETSQVAPA

Affinity tags

N-terminal His / C-terminal Rho1D4
Size (excluding
signal sequence)
436 amino acids, 48,13 kDa

Expression system

Sf9 (baculovirus)

Purified via

Rho1D4 affinity chromatography, size exclusion chromatography

Buffer

50 mM HEPES, pH 8.0; 200 mM NaCl; 10% Glycerol; 0.1% n-Decyl-beta-maltoside; 0.01% cholesterolhemisuccinate; 0.01% CHAPSO

Purity (SDS-PAGE)

>95% as determined by SDS-PAGE

Homogeneity

Size exclusion chromatography

Activity

Not determined

Function

Receptor for neurotensin. Involved in hypotension, hyperglycemia, hypothermia, antinociception, and regulation of intestinal motility and secretion.

Select Country
Results 1 - 1 of 1

NTSR1

No image set
Current Stock Level

NTSR1 protein (10 ug)

Sales price: 898,00 €

Product details