Active, purified Sensory rhodopsin-1 (Halobacterium salinarum)

Sensory rhodopsin-1 (SR-1) is a 7-transmembrane protein that acts as a phototaxis receptor in archaebacteria. Due to its covalently bound colored ligand, SR-1 is ideal for use as a  control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide SR-1 of high purity, purified from E.coli as a his-tagged protein.

Please contact us for bulk inquiries, academic projects or collaboration ideas.

 

Active Membrane Proteins


   

Figure 1: SDS-PAGE of sensory rhodopsin-1 from H. salinarum.
Figure 2: Absorbance spectrum of sensory rhodopsin-1 from H. salinarum.

 

Protein

Sensory rhodopsin-1 (SR-1, HsSRI)

UniProt / UniGene

P0DMH8

Protein class

7-transmembrane protein

Organism

Halobacterium salinarum S9

Sequence

wild-type sequence 1-234 aa (lacking 15 aa at the C-terminus), 10x His-tag (red)
 

MDAVATAYLGGAVALIVGVAFVWLLYRSLDGSPHQSALAPLAIIPVFAGLSYVGMAYDIGTV

IVNGNQIVGLRYIDWLVTTPILVGYVGYAAGASRRSIIGVMVADALMIAVGAGAVVTDGTLK

WALFGVSSIFHLSLFAYLYVIFPRVVPDVPEQIGLFNLLKNHIGLLWLAYPLVWLFGPAGIGEA

TAAGVALTYVFLDVLAKVPYVYFFYARRRVFMHSESHHHHHHHHHH

Affinity tags

His-tag (C-terminus)
Size
234 amino acids; 25,423 Da

Expression system

E.coli

Purified via

PureCube Ni-NTA Agarose

Buffer

4 M NaCl, 50 mM MES pH 6.0, 0.03% dodecyl maltoside (DDM)

Purity (SDS-PAGE)

>98%, see Fig. 1
Absorbance Extinction coefficient at 590 nm: 54,000 M-1 cm-1.

Activity

Binding of ligand all-trans retinal, covalently bound to a lysine residue.

Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 590 nm = 1.7

Function

Photoreceptor protein undergoing a photocycle, Retinal protein, phototaxis receptor
Literature  references:
1. Radu I, Budyak IL, Hoomann T, Kim YJ, Engelhard M, Labahn J, Büldt G, Heberle J, Schlesinger R. (2010) Signal relay from sensory rhodopsin I to the cognate transducer HtrI: assessing the critical change in hydrogen-bonding between Tyr-210 and Asn-53. Biophys Chem. Aug;150(1-3):23-8. doi:
10.1016/j.bpc.2010.02.017. Epub 2010 Mar 2.
2. Schmies G, Chizhov I, Engelhard M. (2000) Functional expression of His-tagged sensory rhodopsin I in Escherichia coli. FEBS Lett. Jan 21;466(1):67-9.

Select Country
Results 1 - 1 of 1

Sensory rhodopsin-1 (Hs)

28911_100px
Current Stock Level

Sensory rhodopsin-1_Hs (100 ug)

Sales price: 300,00 €

Product details