Active, purified Sensory rhodopsin-2 (Halobacterium salinarum)

Sensory rhodopsin-2 (SR-2) is a 7-transmembrane protein that acts as a phototaxis receptor in archaebacteria. Due to its covalently bound colored ligand, SR-2 is ideal for use as a  control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide SR-2 of high purity, purified from E. coli as a his-tagged protein.

Please contact us for bulk inquiries, academic projects or collaboration ideas.

 

Active Membrane Proteins


   

Figure 1: SDS-PAGE of sensory rhodopsin-2 from H. salinarum.
Figure 2: Absorbance spectrum of sensory rhodopsin-2 from H. salinarum.

 

Protein

Sensory rhodopsin-2 (SR-2, HsSRII)

UniProt / UniGene

P71411

Protein class

7-transmembrane protein

Organism

Halobacterium salinarum S9

Sequence

wild-type sequence, full-length, 6x His-tag (red)
 

MALTTWFWVGAVGMLAGTVLPIRDCIRHPSHRRYDLVLAGITGLAAIAYTTMGLGITATTVG

DRTVYLARYIDWLVTTPLIVLYLAMLARPGHRTSAWLLAADVFVIAAGIAAALTTGVQRWLF

FAVGAAGYAALLYGLLGTLPRALGDDPRVRSLFVTLRNITVVLWTLYPVVWLLSPAGIGILQ

TEMYTIVVVYLDFISKVAFVAFAVLGADAVSRLVAADAAAPATAEPTPDGDHHHHHH

Affinity tags

His-tag (C-terminus)
Size
243 amino acids; 26,103 Da

Expression system

E.coli

Purified via

PureCube Ni-NTA Agarose

Buffer

4 M NaCl, 50 mM MES pH 6.0, 0.03% dodecyl maltoside (DDM)

Purity (SDS-PAGE)

>98%, see Fig. 1
Absorbance Extinction coefficient at 497 nm: 48,000 M-1 cm-1.

Activity

Binding of ligand all-trans retinal, covalently bound to a lysine residue.

Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 497 nm = 1.7

(additional vibronic bands at 460 nm and 420 nm)

Function

Photoreceptor protein undergoing a photocycle, Retinal protein, photophobic phototaxis receptor
Literature  references:
1. Mironova OS, Efremov RG, Person B, Heberle J, Budyak IL, Büldt G, Schlesinger R. (2005)
Functional characterization of sensory rhodopsin II from Halobacterium salinarum expressed in Escherichia coli. FEBS Lett. Jun 6;579(14):3147-51

Select Country
Results 1 - 1 of 1

Sensory rhodopsin-2 (Hs)

28921_100px
Current Stock Level

Sensory rhodopsin-2_Hs (100 ug)

Sales price: 300,00 €

Product details