Active, purified Sensory rhodopsin-2 (Natronomonas pharaonis)

Sensory rhodopsin-2 (SR-2) is a 7-transmembrane protein that acts as a phototaxis receptor in archaebacteria. Due to its covalently bound colored ligand, SR-2 is ideal for use as a  control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide SR-2 of high purity, purified from E. coli as a his-tagged protein.

Please contact us for bulk inquiries, academic projects or collaboration ideas.

 

Active Membrane Proteins


   

Figure 1: SDS-PAGE of sensory rhodopsin-2 from N. pharaonis.
Figure 2: Absorbance spectrum of sensory rhodopsin-2 from N. pharaonis.

 

Protein

Sensory rhodopsin-2 (SR-2, NpSRII)

UniProt / UniGene

P42196

Protein class

7-transmembrane protein

Organism

Natronomonas pharaonis (Natronobacterium pharaonis)

Sequence

wild-type sequence, full-length, 7x His-tag (red)
 

MVGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGW

VPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERY

ALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLLGPPGVAL

 LTPTVDVALIVYLDLVTKVGFGFIALDAAATLRAEHGESLAGVDTDAPAVADHHHHHHH

Affinity tags

His-tag (C-terminus)
Size
246 amino acids; 26,315 Da

Expression system

E.coli

Purified via

PureCube Ni-NTA Agarose

Buffer

300 mM NaCl, 50 mM MES pH 6.0, 0.03% dodecyl maltoside (DDM)

Purity (SDS-PAGE)

>98%, see Fig. 1
Absorbance Extinction coefficient at 500 nm: 45,500 M-1 cm-1.

Activity

Binding of ligand all-trans retinal, covalently bound to a lysine residue.

Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 500 nm = 2.8

Function

Photoreceptor protein undergoing a photocycle, Retinal protein, photophobic phototaxis receptor
Literature  references:
1. Gordeliy VI, Labahn J, Moukhametzianov R, Efremov R, Granzin J, Schlesinger R, Büldt G, Savopol T, Scheidig AJ, Klare JP, Engelhard M. (2002) Molecular basis of transmembrane signalling by sensory rhodopsin II-transducer complex.Nature. Oct 3;419(6906):484-7.
2. Orekhov P, Bothe A, Steinhoff HJ, Shaitan KV, Raunser S, Fotiadis D, Schlesinger R, Klare JP, Engelhard M. (2017) SensoryRhodopsin I and Sensory Rhodopsin II Form Trimers of Dimers in Complex with their Cognate Transducers. Photochem Photobiol. 2017 May;93(3):796-804. doi: 10.1111/php.12763.

Select Country
Results 1 - 1 of 1

Sensory rhodopsin-2 (Np)

28931_100px
Current Stock Level

Sensory rhodopsin-2_Np (100 ug)

Sales price: 300,00 €

Product details