GST-eGFP fusion protein, DYKDDDDK-tag

GST-eGFP fusion protein, DYKDDDDK-tag
$271.20 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29921
Every well-performed experiment needs a positive and negativ controll during its run. THis of... more
Product information "GST-eGFP fusion protein, DYKDDDDK-tag"
Every well-performed experiment needs a positive and negativ controll during its run. THis of course also applies to protein purifications processes. For this purpose we created this GST-eGFP fusion protein, that is tagged with the commonly used FLAG-tag. Therefore, it contains multiple affinity tags and can therefore be used as a positive control for different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal DYKDDDDK-tag

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP Spacer, DYKDDDDK-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
LVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGDYKDDDDK-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), FLAG / DYKDDDDK-tag (C-terminus)
Size (kDA) 55.5 kDA
Size (Amino Acid count) 486 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, DYKDDDDK-tag"
PureCube 1-step batch Mini PureCube 1-step batch Mini
Article number: 63104
Sales price: From $129.60 *
PureCube NHS Activated MagBeads PureCube NHS Activated MagBeads
Article number: 50401
Sales price: From $247.20 *
PureCube Ni-IDA Agarose PureCube Ni-IDA Agarose
Article number: 30103
Sales price: From $70.08 * $87.60 *
GST-eGFP fusion protein, Rho1D4-tag GST-eGFP fusion protein, Rho1D4-tag
Article number: 29911
Sales price: From $271.20 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From $240.00 *
SARS-CoV-2 spike protein in SMALP 200 (25µg) SARS-CoV-2 spike protein in SMALP 200 (25µg)
Article number: 28715
Sales price: $1,051.20 *
PureCube 100 Compact Cartridge Ni-INDIGO PureCube 100 Compact Cartridge Ni-INDIGO
Article number: 75302
Sales price: From $62.40 *
PureCube 100 INDIGO Ni-Agarose PureCube 100 INDIGO Ni-Agarose
Article number: 75103
Sales price: From $107.52 * $134.40 *
10X Tris-Acetate-EDTA (TAE), pH 8.3 (2.5 L) 10X Tris-Acetate-EDTA (TAE), pH 8.3 (2.5 L)
Article number: 61252
Sales price: $397.20 *
Rho Starter Set 2: PureCube Rho1D4 MagBeads (1 ml) + Rho1D4 peptide (5 mg) Rho Starter Set 2: PureCube Rho1D4 MagBeads (1...
Article number: 33299
Sales price: $218.40 * $436.80 *
PureCube NTA MagBeads PureCube NTA MagBeads
Article number: 31801
Sales price: From $78.00 *
PureCube Ni-NTA MagBeads PureCube Ni-NTA MagBeads
Article number: 31201
Sales price: From $78.00 *
PureCube Ni-IDA Cartridge PureCube Ni-IDA Cartridge
Article number: 30301
Sales price: From $40.80 *
NTSR1 protein NTSR1 protein
Article number: 28301
Sales price: From $1,156.80 *
Nanodisc MSP1E3D1 POPC (50 µL) Nanodisc MSP1E3D1 POPC (50 µL)
Article number: 26363
Sales price: $664.80 *
Nanodisc MSP1E3D1-His POPC (50 µL) Nanodisc MSP1E3D1-His POPC (50 µL)
Article number: 26353
Sales price: $457.92 * $508.80 *
Cube MagBead Separator (1) Cube MagBead Separator (1)
Article number: 16941
Sales price: From $78.00 *
Isopropyl beta-D-1-thiogalactopyranoside (IPTG) Isopropyl beta-D-1-thiogalactopyranoside (IPTG)
Article number: 16602
Sales price: From $90.00 *
1-Oleoyl-rac-glycerol (Mono-olein), 1 g 1-Oleoyl-rac-glycerol (Mono-olein), 1 g
Article number: 16502
Sales price: $200.40 *
Spike Protein Delta Variant SARS CoV-2 full-length Spike B.1.617.2 (Delta)...
Article number: 28744
Sales price: From $274.80 *
SPIKE protein B.1.429 (CAl. 20C) SARS CoV-2 full-length Spike B.1.525 Mutation
Article number: 28733
Sales price: From $274.80 *
Affinity Chromatogprahy Poster full size Affinity Chromatography Poster
Article number: Affinity-Poster
Sales price: $30.00 *
COVID-19 antibody S2β (spike protein) 100 µg COVID-19 antibody S2β (spike protein) 100 µg
Article number: 28804
Sales price: $346.80 *
SMALP Screening Set (4x3x50 mg) SMALP Screening Set (4x3x50 mg)
Article number: 18280
Sales price: $309.60 *
SMALP 200 SMALP 200
Article number: 18210
Sales price: From $222.00 *
HisCube Kit Elution Buffer 1 x 50 mL HisCube Kit Elution Buffer 1 x 50 mL
Article number: 80187
Sales price: $61.20 *
HisCube Wash Buffer 2 X 50 mL HisCube Wash Buffer 2 X 50 mL
Article number: 80184
Sales price: $73.20 *
SPIKE in LMNG Mycelle, product image SARS CoV-2 spike protein in LMNG detergent
Article number: 28702
Sales price: From $804.00 *
AChR T. Californica AChR T. Californica
Article number: 28601
Sales price: From $1,347.60 *
VGT protein VGT protein
Article number: 28501
Sales price: From $680.40 *
PureCube Fe-NTA MagBeads PureCube Fe-NTA MagBeads
Article number: 31501-Fe
Sales price: From $85.20 *
PureCube Cu-NTA MagBeads PureCube Cu-NTA MagBeads
Article number: 31501-Cu
Sales price: From $85.20 *
8 M Urea (500 mL) 8 M Urea (500 mL)
Article number: 61281
Sales price: $198.00 *
10X Tris-EDTA (TE), pH 7.4 (10 L) 10X Tris-EDTA (TE), pH 7.4 (10 L)
Article number: 61278
Sales price: $258.00 *
10X Tris-buffered saline (TBS), pH 8.0 (10 L) 10X Tris-buffered saline (TBS), pH 8.0 (10 L)
Article number: 61228
Sales price: $580.80 *
10X Phosphate-buffered saline (PBS), pH 7.4 (5 L) 10X Phosphate-buffered saline (PBS), pH 7.4 (5 L)
Article number: 61213
Sales price: $127.20 *
PureCube Carboxy Agarose XL PureCube Carboxy Agarose XL
Article number: 58103
Sales price: From $138.00 *
PureCube Glutathione Agarose XL PureCube Glutathione Agarose XL
Article number: 57003
Sales price: From $220.80 *
PureCube Co-NTA MagBeads XL PureCube Co-NTA MagBeads XL
Article number: 55505
Sales price: From $428.40 *
PentaHis antibody, BSA-free (0.1 mg) PentaHis antibody, BSA-free (0.1 mg)
Article number: 40040
Sales price: $554.40 *
Viewed