GST-eGFP fusion protein, DYKDDDDK-tag

GST-eGFP fusion protein, DYKDDDDK-tag
$306.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29921
Every well-performed experiment needs a positive and negativ controll during its run. THis of... more
Product information "GST-eGFP fusion protein, DYKDDDDK-tag"
Every well-performed experiment needs a positive and negativ controll during its run. THis of course also applies to protein purifications processes. For this purpose we created this GST-eGFP fusion protein, that is tagged with the commonly used FLAG-tag. Therefore, it contains multiple affinity tags and can therefore be used as a positive control for different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal DYKDDDDK-tag

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP Spacer, DYKDDDDK-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
LVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGDYKDDDDK-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), FLAG / DYKDDDDK-tag (C-terminus)
Size (kDA) 55.5 kDA
Size (Amino Acid count) 486 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, DYKDDDDK-tag"
Isopropyl beta-D-1-thiogalactopyranoside (IPTG) Isopropyl beta-D-1-thiogalactopyranoside (IPTG)
Article number: 16602
Sales price: From $102.00 *
Octylglucopyranoside (OG) Octylglucopyranoside (OG)
Article number: 16002
Sales price: From $196.80 *
Cube MagBead Separator (1) Cube MagBead Separator (1)
Article number: 16941
Sales price: From $88.80 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From $270.00 *
8 M Urea (500 mL) 8 M Urea (500 mL)
Article number: 61281
Sales price: $223.20 *
1-Oleoyl-rac-glycerol (Mono-olein), 1 g 1-Oleoyl-rac-glycerol (Mono-olein), 1 g
Article number: 16502
Sales price: $225.60 *
CubeCrystal 2-well MO Plates CubeCrystal 2-well MO Plates
Article number: 10101
Sales price: From $123.60 *
Cell-free E.coli lysate Cell-free E.coli lysate
Article number: 21001
Sales price: From $146.40 *
PureCube Compact Cartridge PureCube Compact Cartridge
Article number: 16912
Sales price: From $32.40 *
Affinity Chromatogprahy Poster full size Affinity Chromatography Poster
Article number: Affinity-Poster
Sales price: $30.00 *
HisCube Kit Elution Buffer 1 x 50 mL HisCube Kit Elution Buffer 1 x 50 mL
Article number: 80187
Sales price: $69.60 *
10X Tris-Acetate-EDTA (TAE), pH 8.3 (2.5 L) 10X Tris-Acetate-EDTA (TAE), pH 8.3 (2.5 L)
Article number: 61252
Sales price: $447.60 *
GST-eGFP fusion protein, Rho1D4-tag GST-eGFP fusion protein, Rho1D4-tag
Article number: 29911
Sales price: From $306.00 *
Detergent Screening Set 2 (1 g each of NG, NM, UDM, TDM, CHAPS) Detergent Screening Set 2 (1 g each of NG, NM,...
Article number: 16094
Sales price: $354.00 *
Detergent Screening Set Classic (1 g each of OG, LDAO, DM, DDM, OTG) Detergent Screening Set Classic (1 g each of...
Article number: 16092
Sales price: $288.00 *
Overview of all Synthetic polymers that are contained in the MAXI screening Kit Synthetic Nanodisc Screening Kit MAXI (16x2x50 mg)
Article number: 18295
Sales price: $780.00 *
SARS-CoV-2 P.1 spike protein SARS CoV-2 full-length Spike P.1 Mutation
Article number: 28722
Sales price: From $309.60 *
10X Tris-EDTA (TE), pH 7.4 (10 L) 10X Tris-EDTA (TE), pH 7.4 (10 L)
Article number: 61278
Sales price: $290.40 *
10X Tris-Borate-EDTA (TBE), pH 8.3 (10 L) 10X Tris-Borate-EDTA (TBE), pH 8.3 (10 L)
Article number: 61248
Sales price: $321.60 *
10X Tris-buffered saline (TBS), pH 8.0 (10 L) 10X Tris-buffered saline (TBS), pH 8.0 (10 L)
Article number: 61228
Sales price: $654.00 *
10X Phosphate-buffered saline (PBS), pH 7.4 (5 L) 10X Phosphate-buffered saline (PBS), pH 7.4 (5 L)
Article number: 61213
Sales price: $144.00 *
PureCube Ni-IDA Cartridge PureCube Ni-IDA Cartridge
Article number: 30301
Sales price: From $46.80 *
PureCube Ni-IDA MagBeads PureCube Ni-IDA MagBeads
Article number: 30201
Sales price: From $61.20 *
Ca Channelopsin 1 Ca Channelopsin 1
Article number: 28941
Sales price: $852.00 *
MSP2N2-His, lyophilized protein MSP2N2-His, lyophilized protein
Article number: 26172
Sales price: From $222.00 *
CHAPS CHAPS
Article number: 16080
Sales price: From $80.40 *
AASTY 11-50 AASTY 11-50
Article number: 18265
Sales price: From $250.80 *
AASTY Screening Kit Contents AASTY Screening Kit (6x2x50 mg)
Article number: 18285
Sales price: $277.20 *
COVID-19 antibody S2α (spike protein) 100 µg COVID-19 antibody S2α (spike protein) 100 µg
Article number: 28803
Sales price: $391.20 *
SMALP Screening Set (4x3x50 mg) SMALP Screening Set (4x3x50 mg)
Article number: 18280
Sales price: $349.20 *
HisCube Wash Buffer 2 X 50 mL HisCube Wash Buffer 2 X 50 mL
Article number: 80184
Sales price: $82.80 *
HisCube Binding Buffer 2 X 50 mL HisCube Binding Buffer 2 X 50 mL
Article number: 80181
Sales price: $82.80 *
PureCube 100 Compact Cartridge Ni-INDIGO PureCube 100 Compact Cartridge Ni-INDIGO
Article number: 75302
Sales price: From $70.80 *
PureCube 100 INDIGO Ni-Cartridge PureCube 100 INDIGO Ni-Cartridge
Article number: 75301
Sales price: From $68.40 *
PureCube 100 Ni-NTA Agarose PureCube 100 Ni-NTA Agarose
Article number: 74103
Sales price: From $142.80 *
PureCube 1-step batch Midi Plus PureCube 1-step batch Midi Plus
Article number: 63203
Sales price: From $67.20 *
PureCube 1-step batch Mini PureCube 1-step batch Mini
Article number: 63104
Sales price: From $146.40 *
PureCube Compact Cartridge Rho1D4 PureCube Compact Cartridge Rho1D4
Article number: 33302
Sales price: From $405.60 *
PureCube Co-NTA MagBeads PureCube Co-NTA MagBeads
Article number: 31501
Sales price: From $96.00 *
PureCube Ni-NTA Cartridge PureCube Ni-NTA Cartridge
Article number: 31301
Sales price: From $49.20 *
Viewed