Channelrhodopsin 1 (Ca) | Pure & Active Membrane Proteins | Products | Cube Biotech

Channelrhodopsin 1 (Ca)


Active, purified Channelrhodopsin 1 (Chloromonas augustae)

Channelrhodopsin 1 is a 7-transmembrane protein that acts as a light-driven cation channel in eukaryotic green algae. Due to its covalently bound colored ligand, it is ideal for use as a control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide channelrhodopsin 1 of high purity, purified from yeast as a his-tagged protein.
Proteins

channelrodopsin1_SDS-Page
Figure 1: SDS-PAGE of channelrhodopsin 1 from C. augustae.
channelrodpsin1_absorbance
Figure 2: Absorbance spectrum of channelrhodopsin 1 from C. augustae.

Protein
Channelrhodopsin 1 (CaChR1)

UniProt / UniGene

Protein class
7-transmembrane protein

Organism
Chloromonas augustae (Chlamydomonas augustae)

Sequence
wild-type sequence, N-terminal membrane-spanning domain (362 of 715 aa), 10x His-tag (red)

 
MDTLAWVARELLSTAHDATPATATPSTDHSTPSTDHGSGETFNVTITIGGGHHGGHAGPVDN SIVIGGIDGWIAIPAGDCYCAGWYVSHGSSFEATFAHVCQWSIFAVCILSLLWYAWQYWKAT CGWEEVYVCCIELVFICFELYHEFDSPCSLYLSTANIVNWLRYSEWLLCCPVILIHLSNVTGLS DDYGRRTMGLLVSDIATIVFGITAAMLVSWPKIIFYLLGFTMCCYTFYLAAKVLIESFHQVPK GICRHLVKAMAITYYVGWSFFPLIFLFGQSGFKKISPYADVIASSFGDLISKNMFGLLGHFLRV KIHEHILKHGDIRKTTHLRIAGEEKEVETFVEEEDEDHHHHHHHHHH

Affinity tags
His-tag (C-terminus)

Size
362 amino acids; 40,661 Da

Expression system
Pichia pastoris (yeast)

Purified via
PureCube Ni-NTA Agarose, size exclusion chromatography

Buffer
100 mM NaCl, 20 mM HEPES pH 7.4, 0.03% dodecyl maltoside (DDM)

Purity (SDS-PAGE)
>98%, see Fig. 1

Absorbance
Extinction coefficient at 518 nm: 36,000 M-1 cm-1.

Absorbance
Extinction coefficient at 590 nm: 54,000 M-1 cm-1.

Activity
Binding of ligand all-trans retinal, covalently bound to a lysine residue. Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 518 nm = 2.2 (additional vibronic band at 480 nm)

Function
Photoreceptor protein undergoing a photocycle, Retinal protein, light-driven cation channel

Literature references
1. Hou SY, Govorunova EG, Ntefidou M, Lane CE, Spudich EN, Sineshchekov OA, Spudich JL. (2012) Diversity of Chlamydomonas channelrhodopsins. Photochem Photobiol. Jan-Feb;88(1):119-28. doi: 10.1111/j.1751-1097.2011.01027.x. Epub 2011 Nov 29.
2. MudersV, Kerruth S, Lórenz-Fonfría VA, Bamann C, Heberle J, Schlesinger R. (2014) Resonance Raman and FTIR spectroscopic characterization of the closed and open states of channelrhodopsin-1. FEBS Lett. Jun 27;588(14):2301-6. doi: 10.1016/j.febslet.2014.05.019. Epub 2014 May 21.
Close window
Channelrhodopsin 1 (Ca)

Active, purified Channelrhodopsin 1 (Chloromonas augustae)

Channelrhodopsin 1 is a 7-transmembrane protein that acts as a light-driven cation channel in eukaryotic green algae. Due to its covalently bound colored ligand, it is ideal for use as a control membrane protein, for example for crystallization assays and biochemical/biophysical experiments. We provide channelrhodopsin 1 of high purity, purified from yeast as a his-tagged protein.
Proteins

channelrodopsin1_SDS-Page
Figure 1: SDS-PAGE of channelrhodopsin 1 from C. augustae.
channelrodpsin1_absorbance
Figure 2: Absorbance spectrum of channelrhodopsin 1 from C. augustae.

Protein
Channelrhodopsin 1 (CaChR1)

UniProt / UniGene

Protein class
7-transmembrane protein

Organism
Chloromonas augustae (Chlamydomonas augustae)

Sequence
wild-type sequence, N-terminal membrane-spanning domain (362 of 715 aa), 10x His-tag (red)

 
MDTLAWVARELLSTAHDATPATATPSTDHSTPSTDHGSGETFNVTITIGGGHHGGHAGPVDN SIVIGGIDGWIAIPAGDCYCAGWYVSHGSSFEATFAHVCQWSIFAVCILSLLWYAWQYWKAT CGWEEVYVCCIELVFICFELYHEFDSPCSLYLSTANIVNWLRYSEWLLCCPVILIHLSNVTGLS DDYGRRTMGLLVSDIATIVFGITAAMLVSWPKIIFYLLGFTMCCYTFYLAAKVLIESFHQVPK GICRHLVKAMAITYYVGWSFFPLIFLFGQSGFKKISPYADVIASSFGDLISKNMFGLLGHFLRV KIHEHILKHGDIRKTTHLRIAGEEKEVETFVEEEDEDHHHHHHHHHH

Affinity tags
His-tag (C-terminus)

Size
362 amino acids; 40,661 Da

Expression system
Pichia pastoris (yeast)

Purified via
PureCube Ni-NTA Agarose, size exclusion chromatography

Buffer
100 mM NaCl, 20 mM HEPES pH 7.4, 0.03% dodecyl maltoside (DDM)

Purity (SDS-PAGE)
>98%, see Fig. 1

Absorbance
Extinction coefficient at 518 nm: 36,000 M-1 cm-1.

Absorbance
Extinction coefficient at 590 nm: 54,000 M-1 cm-1.

Activity
Binding of ligand all-trans retinal, covalently bound to a lysine residue. Evaluation of UV-VIS spectrum: absorbance ratio 280 nm / 518 nm = 2.2 (additional vibronic band at 480 nm)

Function
Photoreceptor protein undergoing a photocycle, Retinal protein, light-driven cation channel

Literature references
1. Hou SY, Govorunova EG, Ntefidou M, Lane CE, Spudich EN, Sineshchekov OA, Spudich JL. (2012) Diversity of Chlamydomonas channelrhodopsins. Photochem Photobiol. Jan-Feb;88(1):119-28. doi: 10.1111/j.1751-1097.2011.01027.x. Epub 2011 Nov 29.
2. MudersV, Kerruth S, Lórenz-Fonfría VA, Bamann C, Heberle J, Schlesinger R. (2014) Resonance Raman and FTIR spectroscopic characterization of the closed and open states of channelrhodopsin-1. FEBS Lett. Jun 27;588(14):2301-6. doi: 10.1016/j.febslet.2014.05.019. Epub 2014 May 21.
Channelrhodopsin 1 (Ca)
No results were found for the filter!
Channelopsin 1 (Chloromonas augustae, 100 µg) Channelopsin 1 (Chloromonas augustae, 100 µg)
Channelopsin 1 from Chloromonas augustae, pure and ready for use.
Article number: 28941
Sales price: €600.00 *
Viewed