GST-eGFP fusion protein, Rho1D4-tag

GST-eGFP fusion protein, Rho1D4-tag
€255.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29911
Every valid experiments needs positive and negative controlls during its run. So do protein... more
Product information "GST-eGFP fusion protein, Rho1D4-tag"
Every valid experiments needs positive and negative controlls during its run. So do protein purifications. For this purpose we created this GST-eGFP fusion protein. It contains multiple affinity tags and can therefore be used as a positive control for multiple different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal Rho1D4-tag, meant for our Rho1D4-tag protein purification products

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP, Spacer, Rho1D4-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
DLVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGTETSQVAPA-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), Rho1D4-tag (C-terminus)
Size (kDA) 55.4 kDA
Size (Amino Acid count) 487 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, Rho1D4-tag"
PureCube IDA Agarose PureCube IDA Agarose
Article number: 30703
Sales price: From €83.00 *
MSP1D1-His, lyophilized protein MSP1D1-His, lyophilized protein
Article number: 26112
Sales price: From €148.00 *
10X Tris-EDTA (TE), pH 7.4 (10 L) 10X Tris-EDTA (TE), pH 7.4 (10 L)
Article number: 61278
Sales price: €242.00 *
PureCube Rho1D4 Agarose PureCube Rho1D4 Agarose
Article number: 33101
Sales price: From €269.00 *
Octylglucopyranoside (OG) Octylglucopyranoside (OG)
Article number: 16002
Sales price: From €164.00 *
Rho1D4 peptide Rho1D4 peptide
Article number: 16201
Sales price: From €125.00 *
Overview of all Synthetic polymers that are contained in the MAXI screening Kit Synthetic Nanodisc Screening Kit MAXI (16x2x50 mg)
Article number: 18295
Sales price: €650.00 *
AASTY 6-45 by Cube Biotech AASTY 6-45
Article number: 18250
Sales price: From €209.00 *
Synthetic Nanodisc Screening Kit MINI, (8x2x50 mg) Synthetic Nanodisc Screening Kit MINI, (8x2x50 mg)
Article number: 18290
Sales price: €360.00 *
AChR T. Californica AChR T. Californica
Article number: 28601
Sales price: From €632.00 *
Vial containing DIBMA 10 Tris DIBMA 10, TRIS
Article number: 18004
Sales price: From €209.00 *
8 M Urea (500 mL) 8 M Urea (500 mL)
Article number: 61281
Sales price: €186.00 *
10X Tris-buffered saline (TBS), pH 8.0 (10 L) 10X Tris-buffered saline (TBS), pH 8.0 (10 L)
Article number: 61228
Sales price: €545.00 *
PureCube Rho1D4 MagBeads PureCube Rho1D4 MagBeads
Article number: 33201
Sales price: From €286.00 *
Rho Starter Set 1: PureCube Rho1D4 Agarose (1 ml) + Rho1D4 peptide (5 mg) Rho Starter Set 1: PureCube Rho1D4 Agarose (1...
Article number: 33199
Sales price: €197.00 * €394.00 *
PureCube Compact Cartridge NTA PureCube Compact Cartridge NTA
Article number: 31902
Sales price: From €41.00 *
PureCube IDA Cartridge PureCube IDA Cartridge
Article number: 30901
Sales price: From €39.00 *
Nanodisc MSP2N2 POPC (50 µL) Nanodisc MSP2N2 POPC (50 µL)
Article number: 26383
Sales price: €718.00 *
Nanodisc MSP1D1 DMPG (50 µL) Nanodisc MSP1D1 DMPG (50 µL)
Article number: 26335
Sales price: €624.00 *
Nanodisc MSP1D1-His DMPC (50 µL) Nanodisc MSP1D1-His DMPC (50 µL)
Article number: 26311
Sales price: €477.00 *
Cell-free E.coli lysate Cell-free E.coli lysate
Article number: 21001
Sales price: From €122.00 *
Tube containing Ultrasolute™ Amphipol 18 Ultrasolute™ Amphipol 18 HEPES
Article number: 18321
Sales price: From €209.00 *
Tube Containing AASTY 11-55 AASTY 11-55
Article number: 18275
Sales price: From €209.00 *
Tube containing AASTY 6-55 AASTY 6-55
Article number: 18270
Sales price: From €209.00 *
AASTY 11-50 AASTY 11-50
Article number: 18265
Sales price: From €209.00 *
Vial containing AASTY 6-50 AASTY 6-50
Article number: 18260
Sales price: From €209.00 *
Tube containing AASTY 11-45 AASTY 11-45
Article number: 18255
Sales price: From €209.00 *
Vial of 25 µg of Omicron Spike protein SARS CoV-2 full-length Spike B.1.1.529 /...
Article number: 28750
Sales price: From €258.00 *
SARS CoV-2 full-length Spike B.1.621 (Mu) Mutation SARS CoV-2 full-length Spike B.1.621 (Mu) Mutation
Article number: 28747
Sales price: From €258.00 *
Spike Protein Delta Variant SARS CoV-2 full-length Spike B.1.617.2 (Delta)...
Article number: 28744
Sales price: From €258.00 *
B.1.429 Corona mutant available at Cube Biotech SARS CoV-2 full-length Spike B.1.429 Mutation
Article number: 28736
Sales price: From €258.00 *
RB-Domain of the SARS-CoV 2 mutant strain P.1 SARS CoV-2 Spike P.1 Mutation RBD domain
Article number: 28731
Sales price: From €552.00 *
SARS CoV-2 Spike B.1.351 Mutation RBD domain SARS CoV-2 Spike B.1.351 Mutation RBD domain
Article number: 28729
Sales price: From €552.00 *
RBD Domain of SPIKE from Mutant strain B.1.1.7 SARS CoV-2 Spike B.1.1.7 Mutation RBD domain
Article number: 28727
Sales price: From €552.00 *
tube containing SPIKE mutant protein SARS CoV-2 full-length Spike B.1.351 Mutation
Article number: 28719
Sales price: From €258.00 *
COVID-19 Antibody S1 domain (spike protein) 100 µg COVID-19 Antibody S1 domain (spike protein) 100 µg
Article number: 28801
Sales price: €326.00 *
SARS-CoV-2 spike protein in SMALP 140 (25 µg) SARS-CoV-2 spike protein in SMALP 140 (25 µg)
Article number: 28711
Sales price: €1,282.00 *
SMALP Screening Set (4x3x50 mg) SMALP Screening Set (4x3x50 mg)
Article number: 18280
Sales price: €291.00 *
SMALP 140-I SMALP 140-I
Article number: 18230
Sales price: From €209.00 *
SMALP 140 SMALP 140
Article number: 18220
Sales price: From €209.00 *
SMALP 300 SMALP 300
Article number: 18200
Sales price: From €209.00 *
HisCube Kit Elution Buffer 1 x 50 mL HisCube Kit Elution Buffer 1 x 50 mL
Article number: 80187
Sales price: €58.00 *
Viewed