GST-eGFP fusion protein, Rho1D4-tag

GST-eGFP fusion protein, Rho1D4-tag
€219.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29911
Every valid experiments needs positive and negative controlls during its run. So do protein... more
Product information "GST-eGFP fusion protein, Rho1D4-tag"
Every valid experiments needs positive and negative controlls during its run. So do protein purifications. For this purpose we created this GST-eGFP fusion protein. It contains multiple affinity tags and can therefore be used as a positive control for multiple different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST tag protein purification products
  4. C-Terminal Rho1D4 tag, meant for our Rho1D4 tag protein purification products

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST Tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP, Spacer, Rho1D4 tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
DLVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGTETSQVAPA-C-Terminus
Affinity tags GFP tag (N-terminus), GST-Tag (Middle), Rho1D4 tag (C-terminus)
Size (kDA) 55.4 kDA
Size (Amino Acid count) 487 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, Rho1D4-tag"
PureCube IDA Agarose PureCube IDA Agarose
Article number: 30703
Sales price: From €70.00 *
MSP1D1-His, lyophilized protein MSP1D1-His, lyophilized protein
Article number: 26112
Sales price: From €127.00 *
Product Image SPIKE protein in DIBMA SARS CoV-2 spike protein in DIBMA Glycerol
Article number: 28706
Sales price: From €850.00 *
SPIKE in MSP nanodisc, product image SARS CoV-2 Spike protein nanodisc complex
Article number: 29301
Sales price: From €990.00 *
GST-eGFP fusion protein, DYKDDDDK-tag GST-eGFP fusion protein, DYKDDDDK-tag
Article number: 29921
Sales price: From €219.00 *
SPIKE in LMNG Mycelle, product image SARS CoV-2 spike protein in LMNG detergent
Article number: 28702
Sales price: From €650.00 *
PureCube DIBMA 10, HEPES PureCube DIBMA 10, HEPES
Article number: 18002
Sales price: From €281.00 *
Hint!
PureCube DIBMA 10, Screening Kit, 10x50 mg, HEPES PureCube DIBMA 10, Screening Kit, 10x50 mg, HEPES
Article number: 18001
Sales price: €179.00 *
PureCube Cu-NTA Agarose PureCube Cu-NTA Agarose
Article number: 31403-Cu
Sales price: From €107.00 *
PureCube NHS Activated Agarose XL PureCube NHS Activated Agarose XL
Article number: 58303
Sales price: From €143.00 *
Strep antibody HRP Strep antibody HRP
Article number: 40071
Sales price: €248.00 *
PureCube HiCap StrepTactin Agarose PureCube HiCap StrepTactin Agarose
Article number: 34101
Sales price: From €70.00 *
PureCube Rho1D4 Agarose PureCube Rho1D4 Agarose
Article number: 33101
Sales price: From €232.00 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From €194.00 *
SARS CoV-2 spike protein set in LMNG detergent (100 µg), DIBMA Glycerol (25 µg) and nanodisc complex SARS CoV-2 spike protein set in LMNG detergent...
Article number: 28704
Sales price: €2,290.00 *
PureCube DIBMA Mix & Match, Screening Kit, 12x50 mg, TRIS PureCube DIBMA Mix & Match, Screening Kit,...
Article number: 18104
Sales price: €199.00 *
PureCube DIBMA Mix & Match, Screening Kit, 12x50 mg, HEPES PureCube DIBMA Mix & Match, Screening Kit,...
Article number: 18101
Sales price: €199.00 *
PureCube DIBMA Glycerol, 1 g, TRIS PureCube DIBMA Glycerol, TRIS
Article number: 18055
Sales price: From €309.00 *
PureCube DIBMA Glycerol, Screening Kit, 10x50 mg, TRIS PureCube DIBMA Glycerol, Screening Kit, 10x50...
Article number: 18054
Sales price: €197.00 *
PureCube DIBMA Glycerol, 1 g, HEPES PureCube DIBMA Glycerol, HEPES
Article number: 18052
Sales price: From €309.00 *
PureCube DIBMA Glycerol, Screening Kit, 10x50 mg, HEPES PureCube DIBMA Glycerol, Screening Kit, 10x50...
Article number: 18051
Sales price: €197.00 *
PureCube DIBMA Glucosamine, 1 g, TRIS PureCube DIBMA Glucosamine, TRIS
Article number: 18045
Sales price: From €309.00 *
PureCube DIBMA Glucosamine, Screening Kit, 10x50 mg, TRIS PureCube DIBMA Glucosamine, Screening Kit,...
Article number: 18044
Sales price: €197.00 *
PureCube DIBMA Glucosamine, 1 g, HEPES PureCube DIBMA Glucosamine, HEPES
Article number: 18042
Sales price: From €309.00 *
PureCube DIBMA Glucosamine, Screening Kit, 10x50 mg, HEPES PureCube DIBMA Glucosamine, Screening Kit,...
Article number: 18041
Sales price: €197.00 *
PureCube DIBMA 12, TRIS PureCube DIBMA 12, TRIS
Article number: 18015
Sales price: From €281.00 *
PureCube DIBMA 12, HEPES PureCube DIBMA 12, HEPES
Article number: 18012
Sales price: From €281.00 *
PureCube DIBMA 10, TRIS PureCube DIBMA 10, TRIS
Article number: 18005
Sales price: From €281.00 *
PureCube DIBMA 12, Screening Kit, 10x50 mg, TRIS PureCube DIBMA 12, Screening Kit, 10x50 mg, TRIS
Article number: 18014
Sales price: €179.00 *
PureCube DIBMA 12, Screening Kit, 10x50 mg, HEPES PureCube DIBMA 12, Screening Kit, 10x50 mg, HEPES
Article number: 18011
Sales price: €179.00 *
PureCube DIBMA 10, Screening Kit, 10x50 mg, TRIS PureCube DIBMA 10, Screening Kit, 10x50 mg, TRIS
Article number: 18004
Sales price: €179.00 *
PureCube Compact Cartridge Zn-NTA PureCube Compact Cartridge Zn-NTA
Article number: 31602-Zn
Sales price: From €37.00 *
PureCube Compact Cartridge Cu-NTA PureCube Compact Cartridge Cu-NTA
Article number: 31602-Cu
Sales price: From €37.00 *
PureCube Zn-NTA Cartridge PureCube Zn-NTA Cartridge
Article number: 31601-Zn
Sales price: From €37.00 *
PureCube Cu-NTA Cartridge PureCube Cu-NTA Cartridge
Article number: 31601-Cu
Sales price: From €37.00 *
PureCube Zn-NTA MagBeads PureCube Zn-NTA MagBeads
Article number: 31501-Zn
Sales price: From €68.00 *
PureCube Cu-NTA MagBeads PureCube Cu-NTA MagBeads
Article number: 31501-Cu
Sales price: From €68.00 *
PureCube Fe-NTA Agarose PureCube Fe-NTA Agarose
Article number: 31403-Fe
Sales price: From €107.00 *
PureCube Zn-NTA Agarose PureCube Zn-NTA Agarose
Article number: 31403-Zn
Sales price: From €107.00 *
PureCube 100 Compact Cartridge Ni-NTA PureCube 100 Compact Cartridge Ni-NTA
Article number: 74302
Sales price: From €48.00 *
PureCube 100 Ni-NTA Cartridge PureCube 100 Ni-NTA Cartridge
Article number: 74301
Sales price: From €48.00 *
L-Glutathione reduced L-Glutathione reduced
Article number: 61035
Sales price: €111.00 *
Viewed