GST-eGFP fusion protein, Rho1D4-tag

GST-eGFP fusion protein, Rho1D4-tag
€226.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29911
Every valid experiments needs positive and negative controlls during its run. So do protein... more
Product information "GST-eGFP fusion protein, Rho1D4-tag"
Every valid experiments needs positive and negative controlls during its run. So do protein purifications. For this purpose we created this GST-eGFP fusion protein. It contains multiple affinity tags and can therefore be used as a positive control for multiple different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal Rho1D4-tag, meant for our Rho1D4-tag protein purification products

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP, Spacer, Rho1D4-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
DLVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGTETSQVAPA-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), Rho1D4-tag (C-terminus)
Size (kDA) 55.4 kDA
Size (Amino Acid count) 487 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, Rho1D4-tag"
PureCube IDA Agarose PureCube IDA Agarose
Article number: 30703
Sales price: From €73.00 *
MSP1D1-His, lyophilized protein MSP1D1-His, lyophilized protein
Article number: 26112
Sales price: From €131.00 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From €200.00 *
PureCube 1-step batch Midi Plus PureCube 1-step batch Midi Plus
Article number: 63203
Sales price: From €49.00 *
Affinity Chromatogprahy Poster full size Affinity Chromatography Poster
Article number: Affinity-Poster
Sales price: €25.00 *
Nanodisc MSP1D1 dH5 DMPC (50 µL) Nanodisc MSP1D1 dH5 DMPC (50 µL)
Article number: 26341
Sales price: €554.00 *
Rho1D4 peptide Rho1D4 peptide
Article number: 16201
Sales price: From €111.00 *
n-Nonyl-beta-maltoside (NM) n-Nonyl-beta-maltoside (NM)
Article number: 16065
Sales price: From €251.00 *
n-Hexadecyl-phosphocholine (Fos-choline-16) n-Hexadecyl-phosphocholine (Fos-choline-16)
Article number: 16037
Sales price: From €134.00 *
HisCube Kit Elution Buffer 1 x 50 mL HisCube Kit Elution Buffer 1 x 50 mL
Article number: 80187
Sales price: €51.00 *
Rho Starter Set 2: PureCube Rho1D4 MagBeads (1 ml) + Rho1D4 peptide (5 mg) Rho Starter Set 2: PureCube Rho1D4 MagBeads (1...
Article number: 33299
Sales price: €182.00 * €364.00 *
PureCube Rho1D4 MagBeads PureCube Rho1D4 MagBeads
Article number: 33201
Sales price: From €254.00 *
PureCube Glutathione MagBeads PureCube Glutathione MagBeads
Article number: 32205
Sales price: From €52.00 *
PureCube Cartridge PureCube Cartridge
Article number: 16911
Sales price: From €24.00 *
n-Decyl-beta-D-glucopyranoside (DG) n-Decyl-beta-D-glucopyranoside (DG)
Article number: 16060
Sales price: From €251.00 *
n-Undecyl-phosphocholine (Fos-choline-11) n-Undecyl-phosphocholine (Fos-choline-11)
Article number: 16045
Sales price: From €141.00 *
n-Dodecyl-phosphocholine (Fos-choline-12) n-Dodecyl-phosphocholine (Fos-choline-12)
Article number: 16021
Sales price: From €122.00 *
N,N-Dimethyl-n-dodecylamine N-oxide (LDAO) N,N-Dimethyl-n-dodecylamine N-oxide (LDAO)
Article number: 16006
Sales price: From €162.00 *
Vial of SPIKE B.1.617 by Cube Biotech SARS CoV-2 full-length Spike B.1.617 Mutation
Article number: 28739
Sales price: From €229.00 *
tube containing SPIKE mutant protein SARS CoV-2 full-length Spike B.1.351 Mutation
Article number: 28719
Sales price: From €229.00 *
HisCube Wash Buffer 2 X 50 mL HisCube Wash Buffer 2 X 50 mL
Article number: 80184
Sales price: €61.00 *
PureCube INDIGO Ni-MagBeads PureCube INDIGO Ni-MagBeads
Article number: 75201
Sales price: From €72.00 *
L-Glutathione reduced L-Glutathione reduced
Article number: 61035
Sales price: €115.00 *
PureCube Rho1D4 Cartridge PureCube Rho1D4 Cartridge
Article number: 33301
Sales price: From €300.00 *
Rho Starter Set 1: PureCube Rho1D4 Agarose (1 ml) + Rho1D4 peptide (5 mg) Rho Starter Set 1: PureCube Rho1D4 Agarose (1...
Article number: 33199
Sales price: €175.00 * €350.00 *
PureCube Rho1D4 Agarose PureCube Rho1D4 Agarose
Article number: 33101
Sales price: From €239.00 *
PureCube IDA MagBeads PureCube IDA MagBeads
Article number: 30801
Sales price: From €45.00 *
PureCube IDA Agarose PureCube IDA Agarose
Article number: 30703
Sales price: From €73.00 *
PureCube Compact Cartridge Ni-IDA PureCube Compact Cartridge Ni-IDA
Article number: 30302
Sales price: From €34.00 *
PureCube Ni-IDA Cartridge PureCube Ni-IDA Cartridge
Article number: 30301
Sales price: From €34.00 *
PureCube Ni-IDA MagBeads PureCube Ni-IDA MagBeads
Article number: 30201
Sales price: From €45.00 *
OPRM1 protein nanodisc complex OPRM1 protein nanodisc complex
Article number: 29001
Sales price: From €1,633.00 *
Ca Channelopsin 1 Ca Channelopsin 1
Article number: 28941
Sales price: €631.00 *
Nanodisc MSP1E3D1 DMPG (50 µL) Nanodisc MSP1E3D1 DMPG (50 µL)
Article number: 26365
Sales price: €554.00 *
Nanodisc MSP1D1 POPC (50 µL) Nanodisc MSP1D1 POPC (50 µL)
Article number: 26333
Sales price: €554.00 *
MSP1E3D1, lyophilized protein MSP1E3D1, lyophilized protein
Article number: 26162
Sales price: From €251.00 *
PureCube Compact Cartridge PureCube Compact Cartridge
Article number: 16912
Sales price: From €24.00 *
n-Undecyl-beta-maltoside (UDM) n-Undecyl-beta-maltoside (UDM)
Article number: 16070
Sales price: From €251.00 *
n-Nonyl-beta-D-glucopyranoside (NG) n-Nonyl-beta-D-glucopyranoside (NG)
Article number: 16055
Sales price: From €251.00 *
n-Decyl-phosphocholine (Fos-choline-10) n-Decyl-phosphocholine (Fos-choline-10)
Article number: 16041
Sales price: From €123.00 *
n-Dodecyl-beta-maltoside (DDM) n-Dodecyl-beta-maltoside (DDM)
Article number: 16014
Sales price: From €260.00 *
n-Decyl-beta-maltoside (DM) n-Decyl-beta-maltoside (DM)
Article number: 16010
Sales price: From €251.00 *
Viewed