GST-eGFP fusion protein, Rho1D4-tag

GST-eGFP fusion protein, Rho1D4-tag
€226.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29911
Every valid experiments needs positive and negative controlls during its run. So do protein... more
Product information "GST-eGFP fusion protein, Rho1D4-tag"
Every valid experiments needs positive and negative controlls during its run. So do protein purifications. For this purpose we created this GST-eGFP fusion protein. It contains multiple affinity tags and can therefore be used as a positive control for multiple different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal Rho1D4-tag, meant for our Rho1D4-tag protein purification products

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP, Spacer, Rho1D4-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
DLVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGTETSQVAPA-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), Rho1D4-tag (C-terminus)
Size (kDA) 55.4 kDA
Size (Amino Acid count) 487 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, Rho1D4-tag"
PureCube IDA Agarose PureCube IDA Agarose
Article number: 30703
Sales price: From €73.00 *
MSP1D1-His, lyophilized protein MSP1D1-His, lyophilized protein
Article number: 26112
Sales price: From €131.00 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From €200.00 *
Isopropyl beta-D-1-thiogalactopyranoside (IPTG) Isopropyl beta-D-1-thiogalactopyranoside (IPTG)
Article number: 16602
Sales price: From €75.00 *
PureCube Glutathione Cartridge PureCube Glutathione Cartridge
Article number: 32301
Sales price: From €41.00 *
COVID-19 antibody RBD (spike protein) 100 µg COVID-19 antibody RBD (spike protein) 100 µg
Article number: 28802
Sales price: €289.00 *
PureCube 100 Compact Cartridge Ni-INDIGO PureCube 100 Compact Cartridge Ni-INDIGO
Article number: 75302
Sales price: From €52.00 *
10X Tris-EDTA (TE), pH 7.4 (10 L) 10X Tris-EDTA (TE), pH 7.4 (10 L)
Article number: 61278
Sales price: €215.00 *
Rho Starter Set 4: PureCube Compact Cartridge Rho1D4 (1x1 ml) + Rho1D4 peptide (5 mg) Rho Starter Set 4: PureCube Compact Cartridge...
Article number: 33398
Sales price: €205.00 * €410.00 *
PureCube Compact Cartridge Glutathione PureCube Compact Cartridge Glutathione
Article number: 32302
Sales price: From €42.00 *
Cell-free E.coli lysate HiYield Cell-free E.coli lysate HiYield
Article number: 21011
Sales price: From €131.00 *
PureCube Cartridge PureCube Cartridge
Article number: 16911
Sales price: From €24.00 *
SMALP 1100I by Orbiscope SMALP 1100I
Article number: 18230
Sales price: From €185.00 *
HisCube - Ni-INDIGO His-Tag Protein Purification MINI Kit HisCube - Ni-INDIGO His-Tag Protein...
Article number: 80101
Sales price: €474.00 *
SARS CoV-2 spike protein set in LMNG detergent (100 µg), DIBMA Glycerol (25 µg) and nanodisc complex SARS CoV-2 spike protein set in LMNG detergent...
Article number: 28704
Sales price: €2,359.00 *
SPIKE in LMNG Mycelle, product image SARS CoV-2 spike protein in LMNG detergent
Article number: 28702
Sales price: From €670.00 *
SPIKE in MSP nanodisc, product image SARS CoV-2 Spike protein nanodisc complex
Article number: 29301
Sales price: From €1,020.00 *
PureCube Compact Cartridge Al-NTA PureCube Compact Cartridge Al-NTA
Article number: 31602-Al
Sales price: From €39.00 *
PureCube 100 Ni-NTA Cartridge PureCube 100 Ni-NTA Cartridge
Article number: 74301
Sales price: From €50.00 *
L-Glutathione reduced L-Glutathione reduced
Article number: 61035
Sales price: €115.00 *
PureCube Glutathione Agarose XL PureCube Glutathione Agarose XL
Article number: 57003
Sales price: From €184.00 *
PureCube Alprenolol Agarose PureCube Alprenolol Agarose
Article number: 56031
Sales price: From €718.00 *
PureCube NTA MagBeads XL PureCube NTA MagBeads XL
Article number: 55905
Sales price: From €333.00 *
Strep antibody HRP Strep antibody HRP
Article number: 40071
Sales price: €256.00 *
GST antibody (0.1 mg) GST antibody (0.1 mg)
Article number: 40060
Sales price: €491.00 *
PureCube Phenyl Agarose PureCube Phenyl Agarose
Article number: 39103
Sales price: From €57.00 *
PureCube Compact Cartridge HiCap StrepTactin PureCube Compact Cartridge HiCap StrepTactin
Article number: 34302
Sales price: From €114.00 *
PureCube HiCap StrepTactin MagBeads PureCube HiCap StrepTactin MagBeads
Article number: 34201
Sales price: From €81.00 *
PureCube HiCap StrepTactin Agarose PureCube HiCap StrepTactin Agarose
Article number: 34101
Sales price: From €73.00 *
PureCube Compact Cartridge Rho1D4 PureCube Compact Cartridge Rho1D4
Article number: 33302
Sales price: From €300.00 *
PureCube NTA Agarose PureCube NTA Agarose
Article number: 31701
Sales price: From €14.00 *
PureCube Ni-NTA Agarose PureCube Ni-NTA Agarose
Article number: 31103
Sales price: From €103.00 *
PureCube IDA Cartridge PureCube IDA Cartridge
Article number: 30901
Sales price: From €34.00 *
MC4R protein MC4R protein
Article number: 28401
Sales price: From €964.00 *
GLP1R protein GLP1R protein
Article number: 28201
Sales price: From €1,071.00 *
Nanodisc Assembly Kit MSP1D1 dH5-His_DMPC Nanodisc Assembly Kit MSP1D1 dH5-His_DMPC
Article number: 26221
Sales price: €253.00 *
Nanodisc Assembly Kit MSP1D1-His_POPC Nanodisc Assembly Kit MSP1D1-His_POPC
Article number: 26213
Sales price: €253.00 *
MSP2N2, lyophilized protein MSP2N2, lyophilized protein
Article number: 26182
Sales price: From €312.00 *
MSP2N2-His, lyophilized protein MSP2N2-His, lyophilized protein
Article number: 26172
Sales price: From €164.00 *
PureCube Compact Cartridge PureCube Compact Cartridge
Article number: 16912
Sales price: From €24.00 *
n-Tridecyl-phosphocholine (Fos-choline-13) n-Tridecyl-phosphocholine (Fos-choline-13)
Article number: 16025
Sales price: From €141.00 *
Viewed