GST-eGFP fusion protein, Rho1D4-tag

GST-eGFP fusion protein, Rho1D4-tag
€255.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29911
Every valid experiments needs positive and negative controlls during its run. So do protein... more
Product information "GST-eGFP fusion protein, Rho1D4-tag"
Every valid experiments needs positive and negative controlls during its run. So do protein purifications. For this purpose we created this GST-eGFP fusion protein. It contains multiple affinity tags and can therefore be used as a positive control for multiple different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal Rho1D4-tag, meant for our Rho1D4-tag protein purification products

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP, Spacer, Rho1D4-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
DLVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGTETSQVAPA-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), Rho1D4-tag (C-terminus)
Size (kDA) 55.4 kDA
Size (Amino Acid count) 487 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, Rho1D4-tag"
PureCube IDA Agarose PureCube IDA Agarose
Article number: 30703
Sales price: From €83.00 *
MSP1D1-His, lyophilized protein MSP1D1-His, lyophilized protein
Article number: 26112
Sales price: From €148.00 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From €225.00 *
GST-eGFP fusion protein, DYKDDDDK-tag GST-eGFP fusion protein, DYKDDDDK-tag
Article number: 29921
Sales price: From €255.00 *
Cell-free E.coli lysate HiYield-T7 Cell-free E.coli lysate HiYield-T7
Article number: 21031
Sales price: From €148.00 *
8 M Urea (500 mL) 8 M Urea (500 mL)
Article number: 61281
Sales price: €186.00 *
PureCube Glutathione MagBeads PureCube Glutathione MagBeads
Article number: 32205
Sales price: From €59.00 *
COVID-19 antibody RBD (spike protein) 100 µg COVID-19 antibody RBD (spike protein) 100 µg
Article number: 28802
Sales price: €326.00 *
HisCube - Ni-INDIGO His-Tag Protein Purification MINI Kit HisCube - Ni-INDIGO His-Tag Protein...
Article number: 80101
Sales price: €534.00 *
PureCube 100 INDIGO Ni-Agarose PureCube 100 INDIGO Ni-Agarose
Article number: 75103
Sales price: From €126.00 *
PureCube 1-step batch Mini PureCube 1-step batch Mini
Article number: 63104
Sales price: From €122.00 *
PureCube Rho1D4 MagBeads PureCube Rho1D4 MagBeads
Article number: 33201
Sales price: From €286.00 *
PureCube Rho1D4 Agarose PureCube Rho1D4 Agarose
Article number: 33101
Sales price: From €269.00 *
PureCube Glutathione Agarose PureCube Glutathione Agarose
Article number: 32103
Sales price: From €164.00 *
PureCube Ni-NTA MagBeads PureCube Ni-NTA MagBeads
Article number: 31201
Sales price: From €74.00 *
PureCube Ni-NTA Agarose PureCube Ni-NTA Agarose
Article number: 31103
Sales price: From €116.00 *
OPRM1 protein nanodisc complex OPRM1 protein nanodisc complex
Article number: 29001
Sales price: From €1,838.00 *
Ca Channelopsin 1 Ca Channelopsin 1
Article number: 28941
Sales price: €710.00 *
Np Sensory rhodopsin-2 Np Sensory rhodopsin-2
Article number: 28931
Sales price: €356.00 *
Hs Sensory rhodopsin-2 Hs Sensory rhodopsin-2
Article number: 28921
Sales price: €356.00 *
Hs Bacteriorhodopsin Hs Bacteriorhodopsin
Article number: 28903
Sales price: €445.00 *
GLP1R protein GLP1R protein
Article number: 28201
Sales price: From €1,205.00 *
mouse MSP2N2-His, lyophilized protein mouse MSP2N2-His, lyophilized protein
Article number: 26572
Sales price: From €211.00 *
Cell-free E.coli lysate HiYield Cell-free E.coli lysate HiYield
Article number: 21011
Sales price: From €148.00 *
Cell-free E.coli lysate Cell-free E.coli lysate
Article number: 21001
Sales price: From €122.00 *
Rho1D4 peptide Rho1D4 peptide
Article number: 16201
Sales price: From €125.00 *
n-Tridecyl beta-maltoside (TDM) n-Tridecyl beta-maltoside (TDM)
Article number: 16074
Sales price: From €159.00 *
n-Undecyl-beta-maltoside (UDM) n-Undecyl-beta-maltoside (UDM)
Article number: 16070
Sales price: From €283.00 *
n-Decyl-beta-D-glucopyranoside (DG) n-Decyl-beta-D-glucopyranoside (DG)
Article number: 16060
Sales price: From €283.00 *
n-Nonyl-beta-D-glucopyranoside (NG) n-Nonyl-beta-D-glucopyranoside (NG)
Article number: 16055
Sales price: From €283.00 *
RB-Domain of the SARS-CoV 2 mutant strain P.1 SARS CoV-2 Spike P.1 Mutation RBD domain
Article number: 28731
Sales price: From €552.00 *
Affinity Chromatogprahy Poster full size Affinity Chromatography Poster
Article number: Affinity-Poster
Sales price: €25.00 *
SMALP 140 SMALP 140
Article number: 18220
Sales price: From €209.00 *
HisCube Kit Elution Buffer 1 x 50 mL HisCube Kit Elution Buffer 1 x 50 mL
Article number: 80187
Sales price: €58.00 *
DIBMA Screening Kit, HEPES (4x3x50 mg) DIBMA Screening Kit, HEPES (4x3x50 mg)
Article number: 18101
Sales price: €231.00 *
AChR T. Californica AChR T. Californica
Article number: 28601
Sales price: From €1,264.00 *
VGT protein VGT protein
Article number: 28501
Sales price: From €638.00 *
DIBMA 12, TRIS DIBMA 12, TRIS
Article number: 18014
Sales price: From €209.00 *
DIBMA 10, HEPES DIBMA 10, HEPES
Article number: 18001
Sales price: From €209.00 *
PureCube INDIGO Ni-MagBeads PureCube INDIGO Ni-MagBeads
Article number: 75201
Sales price: From €81.00 *
PureCube 100 Ni-NTA Agarose PureCube 100 Ni-NTA Agarose
Article number: 74103
Sales price: From €126.00 *
10X Tris-EDTA (TE), pH 7.4 (10 L) 10X Tris-EDTA (TE), pH 7.4 (10 L)
Article number: 61278
Sales price: €242.00 *
Viewed