GST-eGFP fusion protein, Rho1D4-tag

GST-eGFP fusion protein, Rho1D4-tag
€219.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29911
Every valid experiments needs positive and negative controlls during its run. So do protein... more
Product information "GST-eGFP fusion protein, Rho1D4-tag"
Every valid experiments needs positive and negative controlls during its run. So do protein purifications. For this purpose we created this GST-eGFP fusion protein. It contains multiple affinity tags and can therefore be used as a positive control for multiple different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST tag protein purification products
  4. C-Terminal Rho1D4 tag, meant for our Rho1D4 tag protein purification products

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST Tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP, Spacer, Rho1D4 tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
DLVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGTETSQVAPA-C-Terminus
Affinity tags GFP tag (N-terminus), GST-Tag (Middle), Rho1D4 tag (C-terminus)
Size (kDA) 55.4 kDA
Size (Amino Acid count) 487 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, Rho1D4-tag"
PureCube IDA Agarose PureCube IDA Agarose
Article number: 30703
Sales price: From €70.00 *
MSP1D1-His, lyophilized protein MSP1D1-His, lyophilized protein
Article number: 26112
Sales price: From €114.30 * €127.00 *
L-Glutathione reduced L-Glutathione reduced
Article number: 61035
Sales price: €111.00 *
PureCube Rho1D4 Agarose PureCube Rho1D4 Agarose
Article number: 33101
Sales price: From €197.20 * €232.00 *
PureCube Glutathione Cartridge PureCube Glutathione Cartridge
Article number: 32301
Sales price: From €40.00 *
PureCube Alprenolol Agarose PureCube Alprenolol Agarose
Article number: 56031
Sales price: From €697.00 *
GST antibody (0.1 mg) GST antibody (0.1 mg)
Article number: 40060
Sales price: €476.00 *
Rho1D4 antibody (0.2 mg) Rho1D4 antibody (0.2 mg)
Article number: 40020
Sales price: €279.00 *
PureCube Glutathione MagBeads PureCube Glutathione MagBeads
Article number: 32205
Sales price: From €50.00 *
Nanodisc MSP2N2 DMPG (50 µL) Nanodisc MSP2N2 DMPG (50 µL)
Article number: 26385
Sales price: €619.00 *
Nanodisc MSP2N2 POPC (50 µL) Nanodisc MSP2N2 POPC (50 µL)
Article number: 26383
Sales price: €619.00 *
Nanodisc MSP2N2 DMPC (50 µL) Nanodisc MSP2N2 DMPC (50 µL)
Article number: 26381
Sales price: €619.00 *
Nanodisc MSP1E3D1 DMPG (50 µL) Nanodisc MSP1E3D1 DMPG (50 µL)
Article number: 26365
Sales price: €537.00 *
Nanodisc MSP1E3D1 POPC (50 µL) Nanodisc MSP1E3D1 POPC (50 µL)
Article number: 26363
Sales price: €537.00 *
Nanodisc MSP1D1 dH5 DMPG (50 µL) Nanodisc MSP1D1 dH5 DMPG (50 µL)
Article number: 26345
Sales price: €537.00 *
Nanodisc MSP1D1 dH5 POPC (50 µL) Nanodisc MSP1D1 dH5 POPC (50 µL)
Article number: 26343
Sales price: €537.00 *
Nanodisc MSP1D1 DMPG (50 µL) Nanodisc MSP1D1 DMPG (50 µL)
Article number: 26335
Sales price: €537.00 *
Nanodisc MSP1D1 POPC (50 µL) Nanodisc MSP1D1 POPC (50 µL)
Article number: 26333
Sales price: €537.00 *
Rho1D4 peptide Rho1D4 peptide
Article number: 16201
Sales price: From €107.00 *
HisCube - Ni-INDIGO His-Tag Protein Purification MIDI Kit HisCube - Ni-INDIGO His-Tag Protein...
Article number: 80105
Sales price: €440.00 *
HisCube - Ni-INDIGO His-Tag Protein Purification MINI Kit HisCube - Ni-INDIGO His-Tag Protein...
Article number: 80101
Sales price: €460.00 *
Nanodisc mouse MSP2N2-His_DMPG (50 µl) Nanodisc mouse MSP2N2-His_DMPG (50 µl)
Article number: 26775
Sales price: €540.00 *
Nanodisc mouse MSP2N2-His_DMPC (50 µl) Nanodisc mouse MSP2N2-His_DMPC (50 µl)
Article number: 26771
Sales price: €540.00 *
PureCube DIBMA 12, HEPES PureCube DIBMA 12, HEPES
Article number: 18012
Sales price: From €238.85 * €281.00 *
PureCube DIBMA 10, Screening Kit, 10x50 mg, TRIS PureCube DIBMA 10, Screening Kit, 10x50 mg, TRIS
Article number: 18004
Sales price: €152.15 * €179.00 *
Hint!
PureCube DIBMA 10, Screening Kit, 10x50 mg, HEPES PureCube DIBMA 10, Screening Kit, 10x50 mg, HEPES
Article number: 18001
Sales price: €152.15 * €179.00 *
PureCube Zn-NTA MagBeads PureCube Zn-NTA MagBeads
Article number: 31501-Zn
Sales price: From €68.00 *
PureCube Fe-NTA MagBeads PureCube Fe-NTA MagBeads
Article number: 31501-Fe
Sales price: From €68.00 *
PureCube Cu-NTA MagBeads PureCube Cu-NTA MagBeads
Article number: 31501-Cu
Sales price: From €68.00 *
PureCube 100 Compact Cartridge Ni-INDIGO PureCube 100 Compact Cartridge Ni-INDIGO
Article number: 75302
Sales price: From €50.00 *
PureCube INDIGO Ni-MagBeads PureCube INDIGO Ni-MagBeads
Article number: 75201
Sales price: From €69.00 *
PureCube 100 INDIGO Ni-Agarose PureCube 100 INDIGO Ni-Agarose
Article number: 75103
Sales price: From €86.40 * €108.00 *
PureCube 100 Ni-NTA Agarose PureCube 100 Ni-NTA Agarose
Article number: 74103
Sales price: From €86.40 * €108.00 *
PureCube 1-step batch Midi Plus PureCube 1-step batch Midi Plus
Article number: 63203
Sales price: From €47.00 *
PureCube Amine Activated MagBeads XL PureCube Amine Activated MagBeads XL
Article number: 58905
Sales price: From €538.00 *
PureCube NHS Activated MagBeads XL PureCube NHS Activated MagBeads XL
Article number: 58405
Sales price: From €608.00 *
PureCube Ni-NTA MagBeads XL PureCube Ni-NTA MagBeads XL
Article number: 55305
Sales price: From €346.00 *
PureCube Maleimide Activated MagBeads PureCube Maleimide Activated MagBeads
Article number: 51201
Sales price: From €138.00 *
PureCube Amine Activated MagBeads PureCube Amine Activated MagBeads
Article number: 50901
Sales price: From €99.00 *
PureCube Epoxy Activated MagBeads PureCube Epoxy Activated MagBeads
Article number: 50801
Sales price: From €99.00 *
PureCube NHS Activated MagBeads PureCube NHS Activated MagBeads
Article number: 50401
Sales price: From €110.00 *
PureCube NHS Activated Agarose PureCube NHS Activated Agarose
Article number: 50303
Sales price: From €117.00 *
Viewed