GST-eGFP fusion protein, Rho1D4-tag

GST-eGFP fusion protein, Rho1D4-tag
€255.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29911
Every valid experiments needs positive and negative controlls during its run. So do protein... more
Product information "GST-eGFP fusion protein, Rho1D4-tag"
Every valid experiments needs positive and negative controlls during its run. So do protein purifications. For this purpose we created this GST-eGFP fusion protein. It contains multiple affinity tags and can therefore be used as a positive control for multiple different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal Rho1D4-tag, meant for our Rho1D4-tag protein purification products

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP, Spacer, Rho1D4-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
DLVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGTETSQVAPA-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), Rho1D4-tag (C-terminus)
Size (kDA) 55.4 kDA
Size (Amino Acid count) 487 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, Rho1D4-tag"
PureCube IDA Agarose PureCube IDA Agarose
Article number: 30703
Sales price: From €83.00 *
MSP1D1-His, lyophilized protein MSP1D1-His, lyophilized protein
Article number: 26112
Sales price: From €148.00 *
1-Oleoyl-rac-glycerol (Mono-olein), 1 g 1-Oleoyl-rac-glycerol (Mono-olein), 1 g
Article number: 16502
Sales price: €188.00 *
GST-eGFP fusion protein, DYKDDDDK-tag GST-eGFP fusion protein, DYKDDDDK-tag
Article number: 29921
Sales price: From €255.00 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From €225.00 *
PureCube Cartridge PureCube Cartridge
Article number: 16911
Sales price: From €27.00 *
Affinity Chromatogprahy Poster full size Affinity Chromatography Poster
Article number: Affinity-Poster
Sales price: €25.00 *
Nanodisc MSP1D1 POPC (50 µL) Nanodisc MSP1D1 POPC (50 µL)
Article number: 26333
Sales price: €624.00 *
n-Nonyl-beta-D-glucopyranoside (NG) n-Nonyl-beta-D-glucopyranoside (NG)
Article number: 16055
Sales price: From €283.00 *
n-Decyl-beta-maltoside (DM) n-Decyl-beta-maltoside (DM)
Article number: 16010
Sales price: From €283.00 *
SMALP 200 SMALP 200
Article number: 18210
Sales price: From €209.00 *
PureCube 1-step batch Mini PureCube 1-step batch Mini
Article number: 63104
Sales price: From €122.00 *
10X Tris-Acetate-EDTA (TAE), pH 8.3 (2.5 L) 10X Tris-Acetate-EDTA (TAE), pH 8.3 (2.5 L)
Article number: 61252
Sales price: €373.00 *
GST antibody (0.1 mg) GST antibody (0.1 mg)
Article number: 40060
Sales price: €553.00 *
Hs Sensory rhodopsin-1 Hs Sensory rhodopsin-1
Article number: 28911
Sales price: €356.00 *
PureCube Compact Cartridge PureCube Compact Cartridge
Article number: 16912
Sales price: From €27.00 *
Isopropyl beta-D-1-thiogalactopyranoside (IPTG) Isopropyl beta-D-1-thiogalactopyranoside (IPTG)
Article number: 16602
Sales price: From €85.00 *
Detergent Screening Set 2 (1 g each of NG, NM, UDM, TDM, CHAPS) Detergent Screening Set 2 (1 g each of NG, NM,...
Article number: 16094
Sales price: €295.00 *
COVID-19 antibody S2α (spike protein) 100 µg COVID-19 antibody S2α (spike protein) 100 µg
Article number: 28803
Sales price: €326.00 *
HisCube Binding Buffer 2 X 50 mL HisCube Binding Buffer 2 X 50 mL
Article number: 80181
Sales price: €69.00 *
PureCube 1-step batch Midi Plus PureCube 1-step batch Midi Plus
Article number: 63203
Sales price: From €56.00 *
10X Phosphate-buffered saline (PBS), pH 7.4 (5 L) 10X Phosphate-buffered saline (PBS), pH 7.4 (5 L)
Article number: 61213
Sales price: €120.00 *
PureCube Rho1D4 Cartridge PureCube Rho1D4 Cartridge
Article number: 33301
Sales price: From €338.00 *
PureCube Glutathione MagBeads PureCube Glutathione MagBeads
Article number: 32205
Sales price: From €59.00 *
PureCube Co-NTA MagBeads PureCube Co-NTA MagBeads
Article number: 31501
Sales price: From €80.00 *
PureCube Ni-NTA Agarose PureCube Ni-NTA Agarose
Article number: 31103
Sales price: From €119.00 *
PureCube IDA Agarose PureCube IDA Agarose
Article number: 30703
Sales price: From €83.00 *
PureCube Compact Cartridge Ni-IDA PureCube Compact Cartridge Ni-IDA
Article number: 30302
Sales price: From €39.00 *
PureCube Ni-IDA MagBeads PureCube Ni-IDA MagBeads
Article number: 30201
Sales price: From €51.00 *
PureCube Ni-IDA Agarose PureCube Ni-IDA Agarose
Article number: 30103
Sales price: From €83.00 *
Np Sensory rhodopsin-2 Np Sensory rhodopsin-2
Article number: 28931
Sales price: €356.00 *
Hs Sensory rhodopsin-2 Hs Sensory rhodopsin-2
Article number: 28921
Sales price: €356.00 *
Hs Bacteriorhodopsin Hs Bacteriorhodopsin
Article number: 28903
Sales price: €445.00 *
Nanodisc MSP1E3D1 POPC (50 µL) Nanodisc MSP1E3D1 POPC (50 µL)
Article number: 26363
Sales price: €624.00 *
Nanodisc MSP1E3D1 DMPC (50 µL) Nanodisc MSP1E3D1 DMPC (50 µL)
Article number: 26361
Sales price: €624.00 *
Nanodisc MSP1D1 dH5 POPC (50 µL) Nanodisc MSP1D1 dH5 POPC (50 µL)
Article number: 26343
Sales price: €624.00 *
Nanodisc MSP1D1 dH5 DMPC (50 µL) Nanodisc MSP1D1 dH5 DMPC (50 µL)
Article number: 26341
Sales price: €624.00 *
Cell-free E.coli lysate HiYield-T7 Cell-free E.coli lysate HiYield-T7
Article number: 21031
Sales price: From €148.00 *
CHAPS CHAPS
Article number: 16080
Sales price: From €67.00 *
n-Decyl-beta-D-glucopyranoside (DG) n-Decyl-beta-D-glucopyranoside (DG)
Article number: 16060
Sales price: From €283.00 *
n-Undecyl-phosphocholine (Fos-choline-11) n-Undecyl-phosphocholine (Fos-choline-11)
Article number: 16045
Sales price: From €159.00 *
n-Decyl-phosphocholine (Fos-choline-10) n-Decyl-phosphocholine (Fos-choline-10)
Article number: 16041
Sales price: From €139.00 *
Viewed