GST-eGFP fusion protein, DYKDDDDK-tag

GST-eGFP fusion protein, DYKDDDDK-tag
€255.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29921
Every well-performed experiment needs a positive and negativ controll during its run. THis of... more
Product information "GST-eGFP fusion protein, DYKDDDDK-tag"
Every well-performed experiment needs a positive and negativ controll during its run. THis of course also applies to protein purifications processes. For this purpose we created this GST-eGFP fusion protein, that is tagged with the commonly used FLAG-tag. Therefore, it contains multiple affinity tags and can therefore be used as a positive control for different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal DYKDDDDK-tag

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP Spacer, DYKDDDDK-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
LVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGDYKDDDDK-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), FLAG / DYKDDDDK-tag (C-terminus)
Size (kDA) 55.5 kDA
Size (Amino Acid count) 486 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, DYKDDDDK-tag"
PureCube Cartridge PureCube Cartridge
Article number: 16911
Sales price: From €27.00 *
Tube Containing DIBMA Glycerol TRIS DIBMA Glycerol, TRIS
Article number: 18054
Sales price: From €229.00 *
PureCube 100 INDIGO Ni-Agarose PureCube 100 INDIGO Ni-Agarose
Article number: 75103
Sales price: From €126.00 *
10X Tris-Borate-EDTA (TBE), pH 8.3 (10 L) 10X Tris-Borate-EDTA (TBE), pH 8.3 (10 L)
Article number: 61248
Sales price: €268.00 *
PureCube Compact Cartridge PureCube Compact Cartridge
Article number: 16912
Sales price: From €27.00 *
Isopropyl beta-D-1-thiogalactopyranoside (IPTG) Isopropyl beta-D-1-thiogalactopyranoside (IPTG)
Article number: 16602
Sales price: From €85.00 *
CubeCrystal 2-well MO Plates CubeCrystal 2-well MO Plates
Article number: 10101
Sales price: From €103.00 *
Tube Containing AASTY 11-55 AASTY 11-55
Article number: 18275
Sales price: From €209.00 *
Affinity Chromatogprahy Poster full size Affinity Chromatography Poster
Article number: Affinity-Poster
Sales price: €25.00 *
RBD Domain of SPIKE from Mutant strain B.1.1.7 SARS CoV-2 Spike B.1.1.7 Mutation RBD domain
Article number: 28727
Sales price: From €552.00 *
tube containing SPIKE mutant protein SARS CoV-2 full-length Spike B.1.351 Mutation
Article number: 28719
Sales price: From €258.00 *
COVID-19 Antibody S1 domain (spike protein) 100 µg COVID-19 Antibody S1 domain (spike protein) 100 µg
Article number: 28801
Sales price: €326.00 *
Synthetic Nanodisc Screening Kit MINI, (8x2x50 mg) Synthetic Nanodisc Screening Kit MINI, (8x2x50 mg)
Article number: 18290
Sales price: €360.00 *
Vial containing DIBMA 12 HEPES DIBMA 12, HEPES
Article number: 18011
Sales price: From €209.00 *
Tube containing DIBMA 10 HEPES DIBMA 10, HEPES
Article number: 18001
Sales price: From €209.00 *
PureCube Cu-NTA Cartridge PureCube Cu-NTA Cartridge
Article number: 31601-Cu
Sales price: From €44.00 *
PureCube Cu-NTA MagBeads PureCube Cu-NTA MagBeads
Article number: 31501-Cu
Sales price: From €80.00 *
PureCube 100 Compact Cartridge Ni-INDIGO PureCube 100 Compact Cartridge Ni-INDIGO
Article number: 75302
Sales price: From €59.00 *
PureCube 1-step batch Midi Plus PureCube 1-step batch Midi Plus
Article number: 63203
Sales price: From €56.00 *
PureCube Glutathione MagBeads PureCube Glutathione MagBeads
Article number: 32205
Sales price: From €59.00 *
Nanodisc MSP2N2 DMPG (50 µL) Nanodisc MSP2N2 DMPG (50 µL)
Article number: 26385
Sales price: €718.00 *
Cube MagBead Separator (1) Cube MagBead Separator (1)
Article number: 16941
Sales price: From €74.00 *
1-Oleoyl-rac-glycerol (Mono-olein), 1 g 1-Oleoyl-rac-glycerol (Mono-olein), 1 g
Article number: 16502
Sales price: €188.00 *
AASTY 11-50 AASTY 11-50
Article number: 18265
Sales price: From €209.00 *
Vial containing AASTY 6-50 AASTY 6-50
Article number: 18260
Sales price: From €209.00 *
Overview of all Synthetic polymers that are contained in the MAXI screening Kit Synthetic Nanodisc Screening Kit MAXI (16x2x50 mg)
Article number: 18295
Sales price: €650.00 *
Tube containing AASTY 11-45 AASTY 11-45
Article number: 18255
Sales price: From €209.00 *
Vial of 25 µg of Omicron Spike protein SARS CoV-2 full-length Spike B.1.1.529 /...
Article number: 28750
Sales price: From €258.00 *
SARS CoV-2 full-length Spike B.1.621 (Mu) Mutation SARS CoV-2 full-length Spike B.1.621 (Mu) Mutation
Article number: 28747
Sales price: From €258.00 *
Spike Protein Delta Variant SARS CoV-2 full-length Spike B.1.617.2 (Delta)...
Article number: 28744
Sales price: From €258.00 *
B.1.429 Corona mutant available at Cube Biotech SARS CoV-2 full-length Spike B.1.429 Mutation
Article number: 28736
Sales price: From €258.00 *
RB-Domain of the SARS-CoV 2 mutant strain P.1 SARS CoV-2 Spike P.1 Mutation RBD domain
Article number: 28731
Sales price: From €552.00 *
SARS-CoV-2 P.1 spike protein SARS CoV-2 full-length Spike P.1 Mutation
Article number: 28722
Sales price: From €258.00 *
ACE2 Ectodomain by Cube Biotech ACE2 receptor (Ectodomain)
Article number: 28621
Sales price: From €291.00 *
COVID-19 antibody S2β (spike protein) 100 µg COVID-19 antibody S2β (spike protein) 100 µg
Article number: 28804
Sales price: €326.00 *
COVID-19 antibody RBD (spike protein) 100 µg COVID-19 antibody RBD (spike protein) 100 µg
Article number: 28802
Sales price: €326.00 *
SARS-CoV-2 spike protein in SMALP 200 (25µg) SARS-CoV-2 spike protein in SMALP 200 (25µg)
Article number: 28715
Sales price: €986.00 *
SARS-CoV-2 spike protein in SMALP 140 (25 µg) SARS-CoV-2 spike protein in SMALP 140 (25 µg)
Article number: 28711
Sales price: €1,282.00 *
SMALP Screening Set (4x3x50 mg) SMALP Screening Set (4x3x50 mg)
Article number: 18280
Sales price: €291.00 *
SMALP 140-I SMALP 140-I
Article number: 18230
Sales price: From €209.00 *
Viewed