GST-eGFP fusion protein, DYKDDDDK-tag

GST-eGFP fusion protein, DYKDDDDK-tag
€219.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29921
Every well-performed experiment needs a positive and negativ controll during its run. THis of... more
Product information "GST-eGFP fusion protein, DYKDDDDK-tag"
Every well-performed experiment needs a positive and negativ controll during its run. THis of course also applies to protein purifications processes. For this purpose we created this GST-eGFP fusion protein, that is tagged with the commonly used FLAG tag. Therefore, it contains multiple affinity tags and can therefore be used as a positive control for different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST tag protein purification products
  4. C-Terminal DYKDDDDK Tag

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST Tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site,, eGFP Spacer, DYKDDDDK Tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
LVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGTETSQVAPA-C-Terminus
Affinity tags GFP tag (N-terminus), GST-Tag (Middle), FLAG / DYJDDDDJ tag (C-terminus)
Size (kDA) 55.5 kDA
Size (Amino Acid count) 486 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, DYKDDDDK-tag"
PureCube Ni-NTA Mag Beads PureCube Ni-NTA Mag Beads
Article number: 31201
Sales price: From €63.00 *
GST-eGFP fusion protein, Rho1D4-tag GST-eGFP fusion protein, Rho1D4-tag
Article number: 29911
Sales price: From €219.00 *
PureCube Cu-NTA Agarose PureCube Cu-NTA Agarose
Article number: 31403-Cu
Sales price: From €107.00 *
PureCube 100 NTA Agarose PureCube 100 NTA Agarose
Article number: 74703
Sales price: From €108.00 *
PureCube Rho1D4 Agarose PureCube Rho1D4 Agarose
Article number: 33101
Sales price: From €232.00 *
Cube MagBead Separator (1) Cube MagBead Separator (1)
Article number: 16941
Sales price: From €63.00 *
PureCube Glutathione Cartridge PureCube Glutathione Cartridge
Article number: 32301
Sales price: From €40.00 *
PureCube Compact Cartridge Zn-NTA PureCube Compact Cartridge Zn-NTA
Article number: 31602-Zn
Sales price: From €37.00 *
PureCube Compact Cartridge Cu-NTA PureCube Compact Cartridge Cu-NTA
Article number: 31602-Cu
Sales price: From €37.00 *
PureCube Zn-NTA Cartridge PureCube Zn-NTA Cartridge
Article number: 31601-Zn
Sales price: From €37.00 *
PureCube Cu-NTA Cartridge PureCube Cu-NTA Cartridge
Article number: 31601-Cu
Sales price: From €37.00 *
PureCube Zn-NTA MagBeads PureCube Zn-NTA MagBeads
Article number: 31501-Zn
Sales price: From €68.00 *
PureCube Cu-NTA MagBeads PureCube Cu-NTA MagBeads
Article number: 31501-Cu
Sales price: From €68.00 *
PureCube Fe-NTA Agarose PureCube Fe-NTA Agarose
Article number: 31403-Fe
Sales price: From €107.00 *
PureCube Zn-NTA Agarose PureCube Zn-NTA Agarose
Article number: 31403-Zn
Sales price: From €107.00 *
PureCube INDIGO Ni-MagBeads PureCube INDIGO Ni-MagBeads
Article number: 75201
Sales price: From €69.00 *
PureCube 100 INDIGO Ni-Agarose PureCube 100 INDIGO Ni-Agarose
Article number: 75103
Sales price: From €108.00 *
PureCube 100 Ni-NTA Agarose PureCube 100 Ni-NTA Agarose
Article number: 74103
Sales price: From €108.00 *
PureCube Glutathione Agarose XL PureCube Glutathione Agarose XL
Article number: 57003
Sales price: From €178.00 *
PureCube IDA Agarose XL PureCube IDA Agarose XL
Article number: 55603
Sales price: From €94.00 *
GST antibody (0.1 mg) GST antibody (0.1 mg)
Article number: 40060
Sales price: €476.00 *
PentaHis antibody, BSA-free (0.1 mg) PentaHis antibody, BSA-free (0.1 mg)
Article number: 40040
Sales price: €448.00 *
PureCube Compact Cartridge Glutathione PureCube Compact Cartridge Glutathione
Article number: 32302
Sales price: From €40.00 *
PureCube Glutathione MagBeads PureCube Glutathione MagBeads
Article number: 32205
Sales price: From €50.00 *
PureCube Glutathione Agarose PureCube Glutathione Agarose
Article number: 32103
Sales price: From €140.00 *
Ca Channelopsin 1 Ca Channelopsin 1
Article number: 28941
Sales price: €612.00 *
MC4R protein MC4R protein
Article number: 28401
Sales price: From €935.00 *
Nanodisc mouse MSP1D1-His DMPG (50 µL) Nanodisc mouse MSP1D1-His DMPG (50 µL)
Article number: 26715
Sales price: €477.00 *
Nanodisc mouse MSP1D1-His POPC (50 µL) Nanodisc mouse MSP1D1-His POPC (50 µL)
Article number: 26713
Sales price: €477.00 *
Nanodisc MSP1E3D1-His POPC Biotinyl PE (50 µl) Nanodisc MSP1E3D1-His POPC Biotinyl PE (50 µl)
Article number: 26453
Sales price: €579.00 *
Nanodisc MSP1E3D1-His DMPC Biotinyl PE (50 µl) Nanodisc MSP1E3D1-His DMPC Biotinyl PE (50 µl)
Article number: 26451
Sales price: €579.00 *
Nanodisc MSP1D1 dH5-His POPC Biotinyl PE (50 µl) Nanodisc MSP1D1 dH5-His POPC Biotinyl PE (50 µl)
Article number: 26423
Sales price: €579.00 *
Nanodisc MSP1D1 dH5-His DMPC Biotinyl PE (50 µl) Nanodisc MSP1D1 dH5-His DMPC Biotinyl PE (50 µl)
Article number: 26421
Sales price: €579.00 *
Nanodisc MSP1D1-His POPC Biotinyl PE (50 µl) Nanodisc MSP1D1-His POPC Biotinyl PE (50 µl)
Article number: 26413
Sales price: €579.00 *
Nanodisc MSP2N2 DMPG (50 µL) Nanodisc MSP2N2 DMPG (50 µL)
Article number: 26385
Sales price: €619.00 *
Nanodisc MSP2N2 POPC (50 µL) Nanodisc MSP2N2 POPC (50 µL)
Article number: 26383
Sales price: €619.00 *
Nanodisc MSP2N2 DMPC (50 µL) Nanodisc MSP2N2 DMPC (50 µL)
Article number: 26381
Sales price: €619.00 *
Nanodisc MSP2N2-His DMPG (50 µL) Nanodisc MSP2N2-His DMPG (50 µL)
Article number: 26375
Sales price: €503.00 *
Nanodisc MSP2N2-His POPC (50 µL) Nanodisc MSP2N2-His POPC (50 µL)
Article number: 26373
Sales price: €503.00 *
Nanodisc MSP1E3D1 DMPG (50 µL) Nanodisc MSP1E3D1 DMPG (50 µL)
Article number: 26365
Sales price: €537.00 *
Viewed