GST-eGFP fusion protein, DYKDDDDK-tag

GST-eGFP fusion protein, DYKDDDDK-tag
€226.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29921
Every well-performed experiment needs a positive and negativ controll during its run. THis of... more
Product information "GST-eGFP fusion protein, DYKDDDDK-tag"
Every well-performed experiment needs a positive and negativ controll during its run. THis of course also applies to protein purifications processes. For this purpose we created this GST-eGFP fusion protein, that is tagged with the commonly used FLAG-tag. Therefore, it contains multiple affinity tags and can therefore be used as a positive control for different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal DYKDDDDK-tag

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP Spacer, DYKDDDDK-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
LVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGDYKDDDDK-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), FLAG / DYKDDDDK-tag (C-terminus)
Size (kDA) 55.5 kDA
Size (Amino Acid count) 486 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, DYKDDDDK-tag"
PureCube Ni-IDA MagBeads PureCube Ni-IDA MagBeads
Article number: 30201
Sales price: From €45.00 *
Ca Channelopsin 1 Ca Channelopsin 1
Article number: 28941
Sales price: €631.00 *
India Corona Virus mutant B.1.617 RB-Domain by Cube Biotech SARS CoV-2 Spike B.1.617 Mutation RBD domain
Article number: 28742
Sales price: From €490.00 *
PureCube 1-step batch Midi Plus PureCube 1-step batch Midi Plus
Article number: 63203
Sales price: From €49.00 *
PureCube Compact Cartridge Co-NTA PureCube Compact Cartridge Co-NTA
Article number: 31602
Sales price: From €39.00 *
PureCube IDA Cartridge PureCube IDA Cartridge
Article number: 30901
Sales price: From €34.00 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From €200.00 *
OPRM1 protein nanodisc complex OPRM1 protein nanodisc complex
Article number: 29001
Sales price: From €1,633.00 *
Hs Sensory rhodopsin-2 Hs Sensory rhodopsin-2
Article number: 28921
Sales price: €316.00 *
SARS-CoV-2 P.1 spike protein SARS CoV-2 full-length Spike P.1 Mutation
Article number: 28722
Sales price: From €229.00 *
HisCube Wash Buffer 2 X 50 mL HisCube Wash Buffer 2 X 50 mL
Article number: 80184
Sales price: €61.00 *
HisCube Binding Buffer 2 X 50 mL HisCube Binding Buffer 2 X 50 mL
Article number: 80181
Sales price: €61.00 *
HisCube - Ni-INDIGO His-Tag Protein Purification MIDI Kit HisCube - Ni-INDIGO His-Tag Protein...
Article number: 80105
Sales price: €454.00 *
PureCube NHS Activated Agarose XL PureCube NHS Activated Agarose XL
Article number: 58303
Sales price: From €148.00 *
PureCube Alprenolol Agarose PureCube Alprenolol Agarose
Article number: 56031
Sales price: From €718.00 *
Rho Starter Set 1: PureCube Rho1D4 Agarose (1 ml) + Rho1D4 peptide (5 mg) Rho Starter Set 1: PureCube Rho1D4 Agarose (1...
Article number: 33199
Sales price: €175.00 * €350.00 *
MSP1D1 dH5-His, lyophilized protein MSP1D1 dH5-His, lyophilized protein
Article number: 26122
Sales price: From €117.90 * €131.00 *
n-Nonyl-phosphocholine (Fos-choline-9) n-Nonyl-phosphocholine (Fos-choline-9)
Article number: 16049
Sales price: From €141.00 *
n-Dodecyl-phosphocholine (Fos-choline-12) n-Dodecyl-phosphocholine (Fos-choline-12)
Article number: 16021
Sales price: From €122.00 *
Spike Protein Delta Variant SARS CoV-2 full-length Spike B.1.617.2 (Delta)...
Article number: 28744
Sales price: From €229.00 *
SPIKE protein B.1.429 (CAl. 20C) SARS CoV-2 full-length Spike B.1.525 Mutation
Article number: 28733
Sales price: From €229.00 *
Affinity Chromatogprahy Poster full size Affinity Chromatography Poster
Article number: Affinity-Poster
Sales price: €25.00 *
SARS CoV-2 Spike B.1.351 Mutation RBD domain SARS CoV-2 Spike B.1.351 Mutation RBD domain
Article number: 28729
Sales price: From €490.00 *
tube containing SPIKE mutant protein SARS CoV-2 full-length Spike B.1.351 Mutation
Article number: 28719
Sales price: From €229.00 *
Spike Protein Assay Set (4x100µg antibody + 100µg CoV-2 spike protein in LMNG) Spike Protein Assay Set (4x100µg antibody +...
Article number: 28811
Sales price: €1,463.00 *
COVID-19 antibody S2β (spike protein) 100 µg COVID-19 antibody S2β (spike protein) 100 µg
Article number: 28804
Sales price: €289.00 *
SARS-CoV-2 spike protein in SMALP 200 (25µg) SARS-CoV-2 spike protein in SMALP 200 (25µg)
Article number: 28715
Sales price: €876.00 *
SARS-CoV-2 spike protein in SMALP 140 (25 µg) SARS-CoV-2 spike protein in SMALP 140 (25 µg)
Article number: 28711
Sales price: €1,139.00 *
SMALP Screening Set (4x3x50 mg) SMALP Screening Set (4x3x50 mg)
Article number: 18280
Sales price: €258.00 *
SMALP 140-I SMALP 140-I
Article number: 18230
Sales price: From €185.00 *
HisCube Kit Elution Buffer 1 x 50 mL HisCube Kit Elution Buffer 1 x 50 mL
Article number: 80187
Sales price: €51.00 *
SPIKE in LMNG Mycelle, product image SARS CoV-2 spike protein in LMNG detergent
Article number: 28702
Sales price: From €670.00 *
PureCube DIBMA Glycerol, 1 g, TRIS DIBMA Glycerol, TRIS
Article number: 18054
Sales price: From €172.55 * €203.00 *
PureCube DIBMA Glucosamine, 1 g, HEPES DIBMA Glucosamine, HEPES
Article number: 18041
Sales price: From €172.55 * €203.00 *
VGT protein VGT protein
Article number: 28501
Sales price: From €567.00 *
DIBMA 10, TRIS DIBMA 10, TRIS
Article number: 18004
Sales price: From €157.25 * €185.00 *
PureCube Compact Cartridge Cu-NTA PureCube Compact Cartridge Cu-NTA
Article number: 31602-Cu
Sales price: From €39.00 *
PureCube Fe-NTA Cartridge PureCube Fe-NTA Cartridge
Article number: 31601-Fe
Sales price: From €39.00 *
PureCube Zn-NTA MagBeads PureCube Zn-NTA MagBeads
Article number: 31501-Zn
Sales price: From €71.00 *
PureCube Fe-NTA MagBeads PureCube Fe-NTA MagBeads
Article number: 31501-Fe
Sales price: From €71.00 *
Viewed