GST-eGFP fusion protein, DYKDDDDK-tag

GST-eGFP fusion protein, DYKDDDDK-tag
€226.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29921
Every well-performed experiment needs a positive and negativ controll during its run. THis of... more
Product information "GST-eGFP fusion protein, DYKDDDDK-tag"
Every well-performed experiment needs a positive and negativ controll during its run. THis of course also applies to protein purifications processes. For this purpose we created this GST-eGFP fusion protein, that is tagged with the commonly used FLAG-tag. Therefore, it contains multiple affinity tags and can therefore be used as a positive control for different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal DYKDDDDK-tag

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP Spacer, DYKDDDDK-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
LVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGDYKDDDDK-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), FLAG / DYKDDDDK-tag (C-terminus)
Size (kDA) 55.5 kDA
Size (Amino Acid count) 486 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, DYKDDDDK-tag"
Tube SARS CoV-2 full-length Spike B.1.1.7 Mutation
Article number: 28716
Sales price: From €229.00 *
Synthetic Nanodisc Screening Kit, (8x2x50 mg) Synthetic Nanodisc Screening Kit, (8x2x50 mg)
Article number: 18290
Sales price: €320.00 *
SMALP 1100I by Orbiscope SMALP 1100I
Article number: 18230
Sales price: From €185.00 *
SMALP 30010S SMALP 30010S
Article number: 18210
Sales price: From €185.00 *
GST-eGFP fusion protein, Rho1D4-tag GST-eGFP fusion protein, Rho1D4-tag
Article number: 29911
Sales price: From €226.00 *
SMALP 40005S by Orbiscope SMALP 40005S
Article number: 18220
Sales price: From €185.00 *
SMALP 25010S SMALP 25010S
Article number: 18200
Sales price: From €185.00 *
SARS CoV-2 spike protein set in LMNG detergent (100 µg), DIBMA Glycerol (25 µg) and nanodisc complex SARS CoV-2 spike protein set in LMNG detergent...
Article number: 28704
Sales price: €2,359.00 *
PureCube DIBMA Glycerol, 1 g, TRIS DIBMA Glycerol, TRIS
Article number: 18054
Sales price: From €203.00 *
DIBMA 10, TRIS DIBMA 10, TRIS
Article number: 18004
Sales price: From €185.00 *
PureCube 100 INDIGO Ni-Cartridge PureCube 100 INDIGO Ni-Cartridge
Article number: 75301
Sales price: From €50.00 *
Rho Starter Set 1: PureCube Rho1D4 Agarose (1 ml) + Rho1D4 peptide (5 mg) Rho Starter Set 1: PureCube Rho1D4 Agarose (1...
Article number: 33199
Sales price: €175.00 * €350.00 *
MSP1D1, lyophilized protein MSP1D1, lyophilized protein
Article number: 26132
Sales price: From €251.00 *
MSP1D1-His, lyophilized protein MSP1D1-His, lyophilized protein
Article number: 26112
Sales price: From €131.00 *
Viewed