GST-eGFP fusion protein, DYKDDDDK-tag

GST-eGFP fusion protein, DYKDDDDK-tag
€255.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29921
Every well-performed experiment needs a positive and negativ controll during its run. THis of... more
Product information "GST-eGFP fusion protein, DYKDDDDK-tag"
Every well-performed experiment needs a positive and negativ controll during its run. THis of course also applies to protein purifications processes. For this purpose we created this GST-eGFP fusion protein, that is tagged with the commonly used FLAG-tag. Therefore, it contains multiple affinity tags and can therefore be used as a positive control for different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal DYKDDDDK-tag

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP Spacer, DYKDDDDK-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
LVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGDYKDDDDK-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), FLAG / DYKDDDDK-tag (C-terminus)
Size (kDA) 55.5 kDA
Size (Amino Acid count) 486 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, DYKDDDDK-tag"
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From €225.00 *
1-Oleoyl-rac-glycerol (Mono-olein), 1 g 1-Oleoyl-rac-glycerol (Mono-olein), 1 g
Article number: 16502
Sales price: €188.00 *
GST-eGFP fusion protein, Rho1D4-tag GST-eGFP fusion protein, Rho1D4-tag
Article number: 29911
Sales price: From €255.00 *
PureCube Compact Cartridge PureCube Compact Cartridge
Article number: 16912
Sales price: From €27.00 *
AASTY Screening Kit Contents AASTY Screening Kit (6x2x50 mg)
Article number: 18285
Sales price: €231.00 *
PureCube Cartridge PureCube Cartridge
Article number: 16911
Sales price: From €27.00 *
AASTY 6-45 by Cube Biotech AASTY 6-45
Article number: 18250
Sales price: From €209.00 *
HisCube Wash Buffer 2 X 50 mL HisCube Wash Buffer 2 X 50 mL
Article number: 80184
Sales price: €69.00 *
HisCube - Ni-INDIGO His-Tag Protein Purification MINI Kit HisCube - Ni-INDIGO His-Tag Protein...
Article number: 80101
Sales price: €534.00 *
PureCube 1-step batch Midi Plus PureCube 1-step batch Midi Plus
Article number: 63203
Sales price: From €56.00 *
10X Tris-EDTA (TE), pH 7.4 (10 L) 10X Tris-EDTA (TE), pH 7.4 (10 L)
Article number: 61278
Sales price: €242.00 *
10X Tris-buffered saline (TBS), pH 8.0 (10 L) 10X Tris-buffered saline (TBS), pH 8.0 (10 L)
Article number: 61228
Sales price: €545.00 *
10X Phosphate-buffered saline (PBS), pH 7.4 (5 L) 10X Phosphate-buffered saline (PBS), pH 7.4 (5 L)
Article number: 61213
Sales price: €120.00 *
MSP2N2-His, lyophilized protein MSP2N2-His, lyophilized protein
Article number: 26172
Sales price: From €185.00 *
Cell-free E.coli lysate HiYield Cell-free E.coli lysate HiYield
Article number: 21011
Sales price: From €148.00 *
CHAPS CHAPS
Article number: 16080
Sales price: From €67.00 *
AASTY 11-50 AASTY 11-50
Article number: 18265
Sales price: From €209.00 *
COVID-19 antibody S2α (spike protein) 100 µg COVID-19 antibody S2α (spike protein) 100 µg
Article number: 28803
Sales price: €326.00 *
HisCube Binding Buffer 2 X 50 mL HisCube Binding Buffer 2 X 50 mL
Article number: 80181
Sales price: €69.00 *
PureCube 1-step batch Mini PureCube 1-step batch Mini
Article number: 63104
Sales price: From €122.00 *
PureCube Compact Cartridge Rho1D4 PureCube Compact Cartridge Rho1D4
Article number: 33302
Sales price: From €338.00 *
PureCube NTA MagBeads PureCube NTA MagBeads
Article number: 31801
Sales price: From €74.00 *
PureCube Co-NTA MagBeads PureCube Co-NTA MagBeads
Article number: 31501
Sales price: From €80.00 *
Nanodisc MSP2N2-His POPC (50 µL) Nanodisc MSP2N2-His POPC (50 µL)
Article number: 26373
Sales price: €584.00 *
Detergent Screening Set Phosphocholines 1 (1 g each of Fos-12, Fos-14, and Fos-16) Detergent Screening Set Phosphocholines 1 (1 g...
Article number: 16093
Sales price: €333.00 *
n-Undecyl-beta-maltoside (UDM) n-Undecyl-beta-maltoside (UDM)
Article number: 16070
Sales price: From €283.00 *
n-Nonyl-beta-maltoside (NM) n-Nonyl-beta-maltoside (NM)
Article number: 16065
Sales price: From €283.00 *
n-Undecyl-phosphocholine (Fos-choline-11) n-Undecyl-phosphocholine (Fos-choline-11)
Article number: 16045
Sales price: From €159.00 *
n-Tetradecyl-phosphocholine (Fos-choline-14) n-Tetradecyl-phosphocholine (Fos-choline-14)
Article number: 16029
Sales price: From €151.00 *
n-Octyl-1-thio-beta-D-glucopyranoside (OTG) n-Octyl-1-thio-beta-D-glucopyranoside (OTG)
Article number: 16018
Sales price: From €168.00 *
n-Decyl-beta-maltoside (DM) n-Decyl-beta-maltoside (DM)
Article number: 16010
Sales price: From €283.00 *
Tube containing Ultrasolute™ Amphipol 18 Ultrasolute™ Amphipol 18 HEPES
Article number: 18321
Sales price: From €209.00 *
Small vtube containign 50 mg of Glyco DIBMA Glyco-DIBMA
Article number: 18411
Sales price: From €229.00 *
Tube containing AASTY 6-55 AASTY 6-55
Article number: 18270
Sales price: From €209.00 *
SPIKE protein B.1.429 (CAl. 20C) SARS CoV-2 full-length Spike B.1.525 Mutation
Article number: 28733
Sales price: From €258.00 *
SARS CoV-2 Spike B.1.351 Mutation RBD domain SARS CoV-2 Spike B.1.351 Mutation RBD domain
Article number: 28729
Sales price: From €552.00 *
Tube SARS CoV-2 full-length Spike B.1.1.7 Mutation
Article number: 28716
Sales price: From €258.00 *
SMALP 200 SMALP 200
Article number: 18210
Sales price: From €209.00 *
SMALP 300 SMALP 300
Article number: 18200
Sales price: From €209.00 *
HisCube Kit Elution Buffer 1 x 50 mL HisCube Kit Elution Buffer 1 x 50 mL
Article number: 80187
Sales price: €58.00 *
Viewed