GST-eGFP fusion protein, DYKDDDDK-tag

GST-eGFP fusion protein, DYKDDDDK-tag
€255.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29921
Every well-performed experiment needs a positive and negativ controll during its run. THis of... more
Product information "GST-eGFP fusion protein, DYKDDDDK-tag"
Every well-performed experiment needs a positive and negativ controll during its run. THis of course also applies to protein purifications processes. For this purpose we created this GST-eGFP fusion protein, that is tagged with the commonly used FLAG-tag. Therefore, it contains multiple affinity tags and can therefore be used as a positive control for different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal DYKDDDDK-tag

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP Spacer, DYKDDDDK-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
LVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGDYKDDDDK-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), FLAG / DYKDDDDK-tag (C-terminus)
Size (kDA) 55.5 kDA
Size (Amino Acid count) 486 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, DYKDDDDK-tag"
PureCube 100 INDIGO Ni-Agarose PureCube 100 INDIGO Ni-Agarose
Article number: 75103
Sales price: From €126.00 *
GST-eGFP fusion protein, Rho1D4-tag GST-eGFP fusion protein, Rho1D4-tag
Article number: 29911
Sales price: From €255.00 *
10X Phosphate-buffered saline (PBS), pH 7.4 (5 L) 10X Phosphate-buffered saline (PBS), pH 7.4 (5 L)
Article number: 61213
Sales price: €120.00 *
Rho Starter Set 2: PureCube Rho1D4 MagBeads (1 ml) + Rho1D4 peptide (5 mg) Rho Starter Set 2: PureCube Rho1D4 MagBeads (1...
Article number: 33299
Sales price: €205.00 * €410.00 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From €225.00 *
PureCube Compact Cartridge PureCube Compact Cartridge
Article number: 16912
Sales price: From €27.00 *
1-Oleoyl-rac-glycerol (Mono-olein), 1 g 1-Oleoyl-rac-glycerol (Mono-olein), 1 g
Article number: 16502
Sales price: €188.00 *
HisCube Wash Buffer 2 X 50 mL HisCube Wash Buffer 2 X 50 mL
Article number: 80184
Sales price: €69.00 *
PureCube 100 Compact Cartridge Ni-INDIGO PureCube 100 Compact Cartridge Ni-INDIGO
Article number: 75302
Sales price: From €59.00 *
8 M Urea (500 mL) 8 M Urea (500 mL)
Article number: 61281
Sales price: €186.00 *
10X Tris-buffered saline (TBS), pH 8.0 (10 L) 10X Tris-buffered saline (TBS), pH 8.0 (10 L)
Article number: 61228
Sales price: €545.00 *
PureCube NHS Activated MagBeads PureCube NHS Activated MagBeads
Article number: 50405
Sales price: From €553.00 *
PureCube Ni-IDA Agarose PureCube Ni-IDA Agarose
Article number: 30103
Sales price: From €83.00 *
Cell-free E.coli lysate HiYield-T7 Cell-free E.coli lysate HiYield-T7
Article number: 21031
Sales price: From €148.00 *
Cell-free E.coli lysate HiYield Cell-free E.coli lysate HiYield
Article number: 21011
Sales price: From €148.00 *
n-Tetradecyl-phosphocholine (Fos-choline-14) n-Tetradecyl-phosphocholine (Fos-choline-14)
Article number: 16029
Sales price: From €151.00 *
n-Dodecyl-beta-maltoside (DDM) n-Dodecyl-beta-maltoside (DDM)
Article number: 16014
Sales price: From €293.00 *
HisCube Binding Buffer 2 X 50 mL HisCube Binding Buffer 2 X 50 mL
Article number: 80181
Sales price: €69.00 *
HisCube - Ni-INDIGO His-Tag Protein Purification MIDI Kit HisCube - Ni-INDIGO His-Tag Protein...
Article number: 80105
Sales price: €511.00 *
HisCube - Ni-INDIGO His-Tag Protein Purification MINI Kit HisCube - Ni-INDIGO His-Tag Protein...
Article number: 80101
Sales price: €534.00 *
PureCube 1-step batch Midi Plus PureCube 1-step batch Midi Plus
Article number: 63203
Sales price: From €56.00 *
Strep antibody HRP Strep antibody HRP
Article number: 40071
Sales price: €288.00 *
Strep antibody (0.1 mg) Strep antibody (0.1 mg)
Article number: 40070
Sales price: €228.00 *
PureCube Compact Cartridge HiCap StrepTactin PureCube Compact Cartridge HiCap StrepTactin
Article number: 34302
Sales price: From €129.00 *
PureCube HiCap StrepTactin MagBeads PureCube HiCap StrepTactin MagBeads
Article number: 34205
Sales price: From €92.00 *
PureCube Rho1D4 Cartridge PureCube Rho1D4 Cartridge
Article number: 33301
Sales price: From €338.00 *
Rho Starter Set 1: PureCube Rho1D4 Agarose (1 ml) + Rho1D4 peptide (5 mg) Rho Starter Set 1: PureCube Rho1D4 Agarose (1...
Article number: 33199
Sales price: €197.00 * €394.00 *
PureCube Rho1D4 Agarose PureCube Rho1D4 Agarose
Article number: 33101
Sales price: From €269.00 *
PureCube Glutathione Agarose PureCube Glutathione Agarose
Article number: 32103
Sales price: From €164.00 *
PureCube NTA MagBeads PureCube NTA MagBeads
Article number: 31801
Sales price: From €74.00 *
PureCube Ni-NTA Agarose PureCube Ni-NTA Agarose
Article number: 31103
Sales price: From €116.00 *
PureCube Ni-IDA Cartridge PureCube Ni-IDA Cartridge
Article number: 30301
Sales price: From €39.00 *
Nanodisc MSP1E3D1 POPC (50 µL) Nanodisc MSP1E3D1 POPC (50 µL)
Article number: 26363
Sales price: €624.00 *
Nanodisc MSP1E3D1-His POPC (50 µL) Nanodisc MSP1E3D1-His POPC (50 µL)
Article number: 26353
Sales price: €477.00 *
Nanodisc MSP1D1-His DMPC (50 µL) Nanodisc MSP1D1-His DMPC (50 µL)
Article number: 26311
Sales price: €477.00 *
PureCube Cartridge PureCube Cartridge
Article number: 16911
Sales price: From €27.00 *
n-Nonyl-beta-maltoside (NM) n-Nonyl-beta-maltoside (NM)
Article number: 16065
Sales price: From €283.00 *
n-Dodecyl-phosphocholine (Fos-choline-12) n-Dodecyl-phosphocholine (Fos-choline-12)
Article number: 16021
Sales price: From €138.00 *
n-Octyl-1-thio-beta-D-glucopyranoside (OTG) n-Octyl-1-thio-beta-D-glucopyranoside (OTG)
Article number: 16018
Sales price: From €168.00 *
Vial of 25 µg of Omicron Spike protein SARS CoV-2 full-length Spike B.1.1.529 /...
Article number: 28750
Sales price: From €258.00 *
Viewed