GST-eGFP fusion protein, DYKDDDDK-tag

GST-eGFP fusion protein, DYKDDDDK-tag
€226.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29921
Every well-performed experiment needs a positive and negativ controll during its run. THis of... more
Product information "GST-eGFP fusion protein, DYKDDDDK-tag"
Every well-performed experiment needs a positive and negativ controll during its run. THis of course also applies to protein purifications processes. For this purpose we created this GST-eGFP fusion protein, that is tagged with the commonly used FLAG-tag. Therefore, it contains multiple affinity tags and can therefore be used as a positive control for different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal DYKDDDDK-tag

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP Spacer, DYKDDDDK-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
LVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGDYKDDDDK-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), FLAG / DYKDDDDK-tag (C-terminus)
Size (kDA) 55.5 kDA
Size (Amino Acid count) 486 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, DYKDDDDK-tag"
GST-eGFP fusion protein, Rho1D4-tag GST-eGFP fusion protein, Rho1D4-tag
Article number: 29911
Sales price: From €226.00 *
10X Tris-Acetate-EDTA (TAE), pH 8.3 (2.5 L) 10X Tris-Acetate-EDTA (TAE), pH 8.3 (2.5 L)
Article number: 61252
Sales price: €331.00 *
Affinity Chromatogprahy Poster full size Affinity Chromatography Poster
Article number: Affinity-Poster
Sales price: €25.00 *
PureCube Co-NTA Agarose PureCube Co-NTA Agarose
Article number: 31403
Sales price: From €111.00 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From €200.00 *
PureCube Compact Cartridge PureCube Compact Cartridge
Article number: 16912
Sales price: From €24.00 *
8 M Urea (500 mL) 8 M Urea (500 mL)
Article number: 61281
Sales price: €165.00 *
10X Phosphate-buffered saline (PBS), pH 7.4 (5 L) 10X Phosphate-buffered saline (PBS), pH 7.4 (5 L)
Article number: 61213
Sales price: €106.00 *
PureCube Glutathione Agarose PureCube Glutathione Agarose
Article number: 32103
Sales price: From €145.00 *
PureCube Ni-IDA Cartridge PureCube Ni-IDA Cartridge
Article number: 30301
Sales price: From €34.00 *
PureCube Ni-IDA Agarose PureCube Ni-IDA Agarose
Article number: 30103
Sales price: From €73.00 *
Nanodisc MSP1D1-His POPC (50 µL) Nanodisc MSP1D1-His POPC (50 µL)
Article number: 26313
Sales price: €424.00 *
n-Undecyl-beta-maltoside (UDM) n-Undecyl-beta-maltoside (UDM)
Article number: 16070
Sales price: From €251.00 *
n-Decyl-beta-D-glucopyranoside (DG) n-Decyl-beta-D-glucopyranoside (DG)
Article number: 16060
Sales price: From €251.00 *
SMALP Screening Set (4x3x50 mg) SMALP Screening Set (4x3x50 mg)
Article number: 18280
Sales price: €258.00 *
AChR T. Californica AChR T. Californica
Article number: 28601
Sales price: From €1,123.00 *
10X Tris-Borate-EDTA (TBE), pH 8.3 (10 L) 10X Tris-Borate-EDTA (TBE), pH 8.3 (10 L)
Article number: 61248
Sales price: €238.00 *
Ca Channelopsin 1 Ca Channelopsin 1
Article number: 28941
Sales price: €631.00 *
Np Sensory rhodopsin-2 Np Sensory rhodopsin-2
Article number: 28931
Sales price: €316.00 *
GLP1R protein GLP1R protein
Article number: 28201
Sales price: From €1,071.00 *
Nanodisc MSP2N2-His POPC (50 µL) Nanodisc MSP2N2-His POPC (50 µL)
Article number: 26373
Sales price: €519.00 *
Nanodisc MSP1E3D1-His DMPC (50 µL) Nanodisc MSP1E3D1-His DMPC (50 µL)
Article number: 26351
Sales price: €424.00 *
MSP1D1-His, lyophilized protein MSP1D1-His, lyophilized protein
Article number: 26112
Sales price: From €131.00 *
PureCube Cartridge PureCube Cartridge
Article number: 16911
Sales price: From €24.00 *
Isopropyl beta-D-1-thiogalactopyranoside (IPTG) Isopropyl beta-D-1-thiogalactopyranoside (IPTG)
Article number: 16602
Sales price: From €75.00 *
n-Hexadecyl-phosphocholine (Fos-choline-16) n-Hexadecyl-phosphocholine (Fos-choline-16)
Article number: 16037
Sales price: From €134.00 *
n-Octyl-1-thio-beta-D-glucopyranoside (OTG) n-Octyl-1-thio-beta-D-glucopyranoside (OTG)
Article number: 16018
Sales price: From €149.00 *
N,N-Dimethyl-n-dodecylamine N-oxide (LDAO) N,N-Dimethyl-n-dodecylamine N-oxide (LDAO)
Article number: 16006
Sales price: From €162.00 *
India Corona Virus mutant B.1.617 RB-Domain by Cube Biotech SARS CoV-2 Spike B.1.617 Mutation RBD domain
Article number: 28742
Sales price: From €490.00 *
RB-Domain of the SARS-CoV 2 mutant strain P.1 SARS CoV-2 Spike P.1 Mutation RBD domain
Article number: 28731
Sales price: From €490.00 *
10X Tris-EDTA (TE), pH 7.4 (10 L) 10X Tris-EDTA (TE), pH 7.4 (10 L)
Article number: 61278
Sales price: €215.00 *
PureCube Glutathione Agarose XL PureCube Glutathione Agarose XL
Article number: 57003
Sales price: From €184.00 *
PureCube Carboxy MagBeads PureCube Carboxy MagBeads
Article number: 50201
Sales price: From €88.00 *
PureCube HiCap StrepTactin Agarose PureCube HiCap StrepTactin Agarose
Article number: 34101
Sales price: From €73.00 *
PureCube Compact Cartridge Co-NTA PureCube Compact Cartridge Co-NTA
Article number: 31602
Sales price: From €39.00 *
PureCube Ni-IDA MagBeads PureCube Ni-IDA MagBeads
Article number: 30201
Sales price: From €45.00 *
OPRM1 protein nanodisc complex OPRM1 protein nanodisc complex
Article number: 29001
Sales price: From €1,633.00 *
Hs Sensory rhodopsin-2 Hs Sensory rhodopsin-2
Article number: 28921
Sales price: €316.00 *
MSP1E3D1, lyophilized protein MSP1E3D1, lyophilized protein
Article number: 26162
Sales price: From €251.00 *
1-Oleoyl-rac-glycerol (Mono-olein), 1 g 1-Oleoyl-rac-glycerol (Mono-olein), 1 g
Article number: 16502
Sales price: €167.00 *
Viewed