GST-eGFP fusion protein, DYKDDDDK-tag

GST-eGFP fusion protein, DYKDDDDK-tag
€226.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29921
Every well-performed experiment needs a positive and negativ controll during its run. THis of... more
Product information "GST-eGFP fusion protein, DYKDDDDK-tag"
Every well-performed experiment needs a positive and negativ controll during its run. THis of course also applies to protein purifications processes. For this purpose we created this GST-eGFP fusion protein, that is tagged with the commonly used FLAG-tag. Therefore, it contains multiple affinity tags and can therefore be used as a positive control for different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST-tag protein purification products
  4. C-Terminal DYKDDDDK-tag

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST-tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP Spacer, DYKDDDDK-tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
LVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGDYKDDDDK-C-Terminus
Affinity tags GFP-tag (N-terminus), GST-tag (Middle), FLAG / DYKDDDDK-tag (C-terminus)
Size (kDA) 55.5 kDA
Size (Amino Acid count) 486 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, DYKDDDDK-tag"
SPIKE in LMNG Mycelle, product image SARS CoV-2 spike protein in LMNG detergent
Article number: 28702
Sales price: From €670.00 *
PureCube Glutathione Agarose PureCube Glutathione Agarose
Article number: 32103
Sales price: From €145.00 *
SARS CoV-2 spike protein set in LMNG detergent (100 µg), DIBMA Glycerol (25 µg) and nanodisc complex SARS CoV-2 spike protein set in LMNG detergent...
Article number: 28704
Sales price: €2,359.00 *
Product Image SPIKE protein in DIBMA SARS CoV-2 spike protein in DIBMA Glycerol
Article number: 28706
Sales price: From €876.00 *
SPIKE in MSP nanodisc, product image SARS CoV-2 Spike protein nanodisc complex
Article number: 29301
Sales price: From €1,020.00 *
DIBMA Screening Kit, HEPES (4x3x50 mg) DIBMA Screening Kit, HEPES (4x3x50 mg)
Article number: 18101
Sales price: €205.00 *
GST antibody (0.1 mg) GST antibody (0.1 mg)
Article number: 40060
Sales price: €491.00 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From €200.00 *
Viewed