GST-eGFP fusion protein, DYKDDDDK-tag

GST-eGFP fusion protein, DYKDDDDK-tag
€219.00 *

Prices plus VAT plus shipping costs

Ready to ship today,
Delivery time appr. 1-3 workdays

µG:

  • 29921
Every well-performed experiment needs a positive and negativ controll during its run. THis of... more
Product information "GST-eGFP fusion protein, DYKDDDDK-tag"
Every well-performed experiment needs a positive and negativ controll during its run. THis of course also applies to protein purifications processes. For this purpose we created this GST-eGFP fusion protein, that is tagged with the commonly used FLAG tag. Therefore, it contains multiple affinity tags and can therefore be used as a positive control for different purification assays. It does contain:
  1. N-Terminal GFP
  2. Multiple cleavage sites
  3. GST-tag, meant for our GST tag protein purification products
  4. C-Terminal DYKDDDDK Tag

Features

 
Protein class Beta-barrel; Autofluorescent Protein
Sequence - Sections named from N-Ter to C-Ter GST Tag, Thrombin cleavage site, HRV3C (PreScission) cleavage site, eGFP Spacer, DYKDDDDK Tag
Sequence - Amino Acids N-terminus-MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS
MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLY
DALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS
LVPRGS
LEVLFQGPMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVT
TLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GSSGDYKDDDDK-C-Terminus
Affinity tags GFP tag (N-terminus), GST-Tag (Middle), FLAG / DYKDDDDK tag (C-terminus)
Size (kDA) 55.5 kDA
Size (Amino Acid count) 486 amino acids
Excitation maximum 488 nm
Fluorescence maximum 509 nm
Purity >98% as determined by SDS-PAGE (see Datasheet)
Related links to "GST-eGFP fusion protein, DYKDDDDK-tag"
PureCube HiCap StrepTactin MagBeads PureCube HiCap StrepTactin MagBeads
Article number: 34201
Sales price: From €78.00 *
PureCube DIBMA Glycerol, 1 g, HEPES PureCube DIBMA Glycerol, HEPES
Article number: 18052
Sales price: From €309.00 *
PureCube Al-NTA Agarose PureCube Al-NTA Agarose
Article number: 31403-Al
Sales price: From €107.00 *
PureCube Glutathione MagBeads XL PureCube Glutathione MagBeads XL
Article number: 57105
Sales price: From €238.00 *
PureCube Glutathione Agarose XL PureCube Glutathione Agarose XL
Article number: 57003
Sales price: From €178.00 *
PureCube NTA MagBeads XL PureCube NTA MagBeads XL
Article number: 55905
Sales price: From €323.00 *
PureCube Maleimide Activated Agarose PureCube Maleimide Activated Agarose
Article number: 51103
Sales price: From €301.00 *
PureCube Amine Activated MagBeads PureCube Amine Activated MagBeads
Article number: 50901
Sales price: From €99.00 *
PureCube Epoxy Activated MagBeads PureCube Epoxy Activated MagBeads
Article number: 50801
Sales price: From €99.00 *
PureCube Epoxy Activated Agarose PureCube Epoxy Activated Agarose
Article number: 50703
Sales price: From €105.00 *
Rho1D4 antibody (0.2 mg) Rho1D4 antibody (0.2 mg)
Article number: 40020
Sales price: €279.00 *
PureCube Rho1D4 Cartridge PureCube Rho1D4 Cartridge
Article number: 33301
Sales price: From €291.00 *
Rho Starter Set 2: PureCube Rho1D4 MagBeads (1 ml) + Rho1D4 peptide (5 mg) Rho Starter Set 2: PureCube Rho1D4 MagBeads (1...
Article number: 33299
Sales price: €177.00 * €353.00 *
PureCube Rho1D4 MagBeads PureCube Rho1D4 MagBeads
Article number: 33201
Sales price: From €209.10 * €246.00 *
PureCube Glutathione Agarose PureCube Glutathione Agarose
Article number: 32103
Sales price: From €112.00 * €140.00 *
PureCube NTA MagBeads PureCube NTA MagBeads
Article number: 31801
Sales price: From €63.00 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From €194.00 *
OPRM1 protein nanodisc complex OPRM1 protein nanodisc complex
Article number: 29001
Sales price: From €1,585.00 *
Ca Channelopsin 1 Ca Channelopsin 1
Article number: 28941
Sales price: €612.00 *
MC4R protein MC4R protein
Article number: 28401
Sales price: From €935.00 *
GPBAR1 (TGR5) protein GPBAR1 (TGR5) protein
Article number: 28101
Sales price: From €1,039.00 *
Nanodisc mouse MSP1D1-His DMPG (50 µL) Nanodisc mouse MSP1D1-His DMPG (50 µL)
Article number: 26715
Sales price: €429.30 * €477.00 *
Nanodisc mouse MSP1D1-His POPC (50 µL) Nanodisc mouse MSP1D1-His POPC (50 µL)
Article number: 26713
Sales price: €429.30 * €477.00 *
mouse MSP2N2, lyophilized protein mouse MSP2N2, lyophilized protein
Article number: 26582
Sales price: From €340.00 *
mouse MSP1D1, lyophilized protein mouse MSP1D1, lyophilized protein
Article number: 26532
Sales price: From €265.00 *
Nanodisc MSP1E3D1-His POPC Biotinyl PE (50 µl) Nanodisc MSP1E3D1-His POPC Biotinyl PE (50 µl)
Article number: 26453
Sales price: €579.00 *
Nanodisc MSP1E3D1-His DMPC Biotinyl PE (50 µl) Nanodisc MSP1E3D1-His DMPC Biotinyl PE (50 µl)
Article number: 26451
Sales price: €579.00 *
Nanodisc MSP1D1 dH5-His POPC Biotinyl PE (50 µl) Nanodisc MSP1D1 dH5-His POPC Biotinyl PE (50 µl)
Article number: 26423
Sales price: €579.00 *
Nanodisc MSP1D1 dH5-His DMPC Biotinyl PE (50 µl) Nanodisc MSP1D1 dH5-His DMPC Biotinyl PE (50 µl)
Article number: 26421
Sales price: €579.00 *
Nanodisc MSP1D1-His POPC Biotinyl PE (50 µl) Nanodisc MSP1D1-His POPC Biotinyl PE (50 µl)
Article number: 26413
Sales price: €579.00 *
Nanodisc MSP1D1-His DMPC Biotinyl PE (50 µl) Nanodisc MSP1D1-His DMPC Biotinyl PE (50 µl)
Article number: 26411
Sales price: €579.00 *
Nanodisc MSP2N2 DMPG (50 µL) Nanodisc MSP2N2 DMPG (50 µL)
Article number: 26385
Sales price: €619.00 *
Nanodisc MSP2N2 POPC (50 µL) Nanodisc MSP2N2 POPC (50 µL)
Article number: 26383
Sales price: €619.00 *
Nanodisc MSP2N2 DMPC (50 µL) Nanodisc MSP2N2 DMPC (50 µL)
Article number: 26381
Sales price: €619.00 *
Nanodisc MSP2N2-His DMPG (50 µL) Nanodisc MSP2N2-His DMPG (50 µL)
Article number: 26375
Sales price: €452.70 * €503.00 *
Nanodisc MSP2N2-His POPC (50 µL) Nanodisc MSP2N2-His POPC (50 µL)
Article number: 26373
Sales price: €452.70 * €503.00 *
Nanodisc MSP1E3D1 DMPG (50 µL) Nanodisc MSP1E3D1 DMPG (50 µL)
Article number: 26365
Sales price: €537.00 *
Nanodisc MSP1E3D1 POPC (50 µL) Nanodisc MSP1E3D1 POPC (50 µL)
Article number: 26363
Sales price: €537.00 *
Nanodisc MSP1E3D1-His DMPG (50 µL) Nanodisc MSP1E3D1-His DMPG (50 µL)
Article number: 26355
Sales price: €369.90 * €411.00 *
Nanodisc MSP1E3D1-His POPC (50 µL) Nanodisc MSP1E3D1-His POPC (50 µL)
Article number: 26353
Sales price: €369.90 * €411.00 *
Viewed