Claudin-4 (CLDN4, CPER, CPETR1, WBSCR8)

Order number: 70061

€12,800.00*

Prices plus VAT plus shipping costs

Ready to ship today

Amount (µg)

Quantity

Description

We are pleased to introduce our off-the-shelf, full-length, active, and native Claudin-4 protein, also known as CLDN4, CPER, CPETR1, and WBSCR8. Claudin-4 is a critical component of tight junctions in epithelial and endothelial cells, playing a key role in maintaining cell polarity and regulating paracellular transport. It is implicated in various physiological processes and diseases, including cancer and viral infections.

Our Claudin-4 protein has been solubilized and stabilized using Cube Biotech's NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

Screening/Validation
Biologics Development
Structure Determination
Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow — **Fig. 1:** Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).

Feature
Alternative names	CLDN4, CPER, CPETR1, WBSCR8
UniProt Number	O14493
Protein class	Claudin
Original host	Homo sapiens
Expression system	HEK293
Sequence, One-Letter Code	MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYVGSSGTETSQVAPA
Affinity tags	Rho1D4-tag (C-terminal)
Size (excluding additional elements)	209 amino acids, 22 kDa
Concentration	0.4 - 0.7 mg/ml
Purity	>90%, determined via SDS-PAGE
Purification process	2-step purification
Shipping	Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function	Channel-forming tight junction protein that mediates paracellular chloride transport in the kidney. Plays a critical role in the paracellular reabsorption of filtered chloride in the kidney collecting ducts. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. {ECO:0000250\|UniProtKB:O35054}.
PubMed ID	9334247, 15489334, 16236711, 20375010, 21269460, 27647526

Lab Results

CLDN4 Eluate +DLS — **Figure 2:** Exemplary in-house SDS-Page and DLS data of CLDN4 NativeMP™ copolymer screens. More in-depth data sets can be accessed upon project initiation.