NTCP - Hepatic sodium/bile acid cotransporter

Order number: 70613

On Request

Ready to ship today

Amount (µg)

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Hepatic sodium/bile acid cotransporter, commonly known as NTCP. The NTCP is a critical transporter of conjugated bile salts from the plasma into the hepatocyte, and it is also involved in the enterohepatic circulation of bile salts, which are necessary for the solubilisation and absorption of dietary fat and fat-soluble vitamins. In addition, the NTCP functions as a receptor for the hepatitis B and D virus.

Our NTCP protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

Screening/Validation
Biologics Development
Structure Determination
Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow — **Fig. 1:** Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).

Feature
Alternative names	NTCP, Cell growth-inhibiting gene 29 protein, Na⁺/bile acid cotransporter, Na⁺/taurocholate transport protein, Sodium/taurocholate cotransporting polypeptide 2 publications, Solute carrier family 10 member 1, SLC10A1
UniProt Number	Q14973
Protein class	SLC transporter
Original host	Homo sapiens
Expression system	HEK293
Sequence, One-Letter Code	MKTIIALSYIFCLVFADYKDHDGDYKDHDIDYKDDDDKDEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTAGSSGTETSQVAPA
Affinity tags	HA signal peptide, 3xFLAG-tag (N-terminal); Rho1D4-tag (C-terminal)
Size (excluding additional elements)	384 amino acids, 42 kDa
Concentration	0.4 - 0.7 mg/ml
Purity	>90%, determined via SDS-PAGE
Purification process	2-step purification
Shipping	Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function	The hepatic sodium/bile acid cotransporter is a critical transporter of conjugated bile salts from the plasma into the hepatocyte, and it is also involved in the enterohepatic circulation of bile salts, which are necessary for the solubilisation and absorption of dietary fat and fat-soluble vitamins. In addition, the NTCP functions as a receptor for the hepatitis B and D virus.
PubMed ID	8132774, 9458785, 11031103, 12409283, 14660639, 23150796, 24867799, 34060352

Lab Results

Hepatitis B & NTCP Eluates, DLS, and MST data — **Figure 2:** Exemplary in-house SDS-Page, DLS, and MST data of NTCP and LHBsAg NativeMP™ copolymer screens. More in-depth data sets can be accessed upon project initiation.