Sodium-dependent serotonin transporter (SLC6A4, SERT)

Order number: 70230

€14,800.00*

Ready to ship today

Amount

Quantity

Description

We are excited to introduce our full-length, active, and native Sodium-dependent Serotonin Transporter protein, encoded by SLC6A4. This essential membrane transporter is involved in moving serotonin with one Na+ ion in exchange for one K+ ion and possibly one proton. Additionally, SLC6A4 is associated with multiple psychiatric disorders, including major depression, anxiety disorders, and substance use disorders.

Our SLC6A4 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, ideal for a variety of research applications.

Applications:

Screening/Validation
Biologics Development
Structure Determination
Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow — **Fig. 1:** Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).

Feature
Alternative names	SLC6A4, SERT, 5HTT
UniProt Number	P31645
Protein class	SLC transporter
Original host	Homo sapiens
Expression system	HEK293
Sequence, One-Letter Code	METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAVGSSGTETSQVAPA
Affinity tags	Rho1D4-tag (C-terminal)
Size (excluding additional elements)	643 amino acids, 70 kDa (forms Dimers)
Concentration	0.4 - 0.7 mg/ml
Purity	>90%, determined via SDS-PAGE
Purification process	2-step purification
Shipping	Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function	Serotonin transporter that cotransports serotonin with one Na+ ion in exchange for one K⁺ ion and possibly one proton in an overall electroneutral transport cycle. Transports serotonin across the plasma membrane from the extracellular compartment to the cytosol thus limiting serotonin intercellular signaling. Essential for serotonin homeostasis in the central nervous system.

Lab Results

SLC6A4 Eluate + DLS — **Figure 2:** Exemplary in-house SDS-Page and DLS data of SLC6A4 NativeMP™ copolymer screens. More in-depth data sets can be accessed upon project initiation.