UCP1 / SLC25A7 - Mitochondrial brown fat uncoupling protein 1
Order number: 70660
Description
We are excited to introduce our off-the-shelf, full-length, active, and native Mitochondrial brown fat uncoupling protein 1, commonly known as UCP1. It is a mitochondrial proton carrier involved in mediating non-shivering thermogenesis in brown fat. It conducts protons across the inner mitochondrial membrane to uncouple mitochondrial respiration from ATP production, and the resulting electrochemical gradient of protons is then converted into heat. It also helps to counteract heat loss in infants. It is associated with several health conditions such as metabolic diseases, obesity and type 2 diabetes.
Our UCP1 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.
Our UCP1 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.
Applications:
- Screening/Validation
- Biologics Development
- Structure Determination
- Small Molecule Drug Development
The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.
For more details, explore our solubilization database.

Datasheets
Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature | |
---|---|
Alternative names | UCP1, Solute carrier family 25 member 7, Thermogenin, UCP, SLC25A7 |
UniProt Number | P25874 |
Protein class | SLC transporter |
Original host | Homo sapiens |
Expression system | HEK293 |
Sequence, One-Letter Code | MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCATGSSGTETSQVAPA |
Affinity tags | Rho1D4-tag (C-terminal) |
Size (excluding additional elements) | 307 amino acids, 33 kDa |
Concentration | 0.4 - 0.7 mg/ml |
Purity | >90%, determined via SDS-PAGE |
Purification process | 2-step purification |
Shipping | Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product. |
Function | Mitochondrial brown fat uncoupling protein 1 is a mitochondrial proton carrier involved in mediating non-shivering thermogenesis in brown fat. It conducts protons across the inner mitochondrial membrane to uncouple mitochondrial respiration from ATP production, and the resulting electrochemical gradient of protons is then converted into heat. It also helps to counteract heat loss in infants. It is associated with several health conditions such as metabolic diseases, obesity and type 2 diabetes. |
PubMed ID | 3165741, 24196960, 23266187, 11317671, 12756473, 28781081 |