UCP1 / SLC25A7 - Mitochondrial brown fat uncoupling protein 1

Order number: 70660

€12,800.00*

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Mitochondrial brown fat uncoupling protein 1, commonly known as UCP1. It is a mitochondrial proton carrier involved in mediating non-shivering thermogenesis in brown fat. It conducts protons across the inner mitochondrial membrane to uncouple mitochondrial respiration from ATP production, and the resulting electrochemical gradient of protons is then converted into heat. It also helps to counteract heat loss in infants. It is associated with several health conditions such as metabolic diseases, obesity and type 2 diabetes.

Our UCP1 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative namesUCP1, Solute carrier family 25 member 7, Thermogenin, UCP, SLC25A7
UniProt Number P25874
Protein class SLC transporter
Original host Homo sapiens
Expression system HEK293
Sequence, One-Letter Code MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCATGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 307 amino acids, 33 kDa
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function Mitochondrial brown fat uncoupling protein 1 is a mitochondrial proton carrier involved in mediating non-shivering thermogenesis in brown fat. It conducts protons across the inner mitochondrial membrane to uncouple mitochondrial respiration from ATP production, and the resulting electrochemical gradient of protons is then converted into heat. It also helps to counteract heat loss in infants. It is associated with several health conditions such as metabolic diseases, obesity and type 2 diabetes.
PubMed ID 3165741, 24196960, 23266187, 11317671, 12756473, 28781081