Tumor necrosis factor (TNF)

Order number: 70190

€10,800.00*

Ready to ship today

Amount (µg)

Quantity

Description

We are proud to introduce our full-length, active, and native Tumor Necrosis Factor (TNF) protein, a key cytokine involved in inflammation and immune system regulation. TNF plays a pivotal role in cell signaling, particularly in the regulation of immune responses, apoptosis, and cell survival. Due to its critical function in inflammation, TNF is a prominent target in the study of autoimmune diseases, cancer therapy, and inflammatory disorders, making it an invaluable tool for research and drug development.

Our Tumor Necrosis Factor protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, ideal for a variety of research applications.

Applications:

Screening/Validation
Biologics Development
Structure Determination
Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow — **Fig. 1:** Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).

Feature
Alternative names	TNF, TNF-alpha, mTNF, Cachectin
UniProt Number	P01375
Protein class	Cytokine (Other)
Original host	Homo sapiens
Expression system	HEK293
Sequence, One-Letter Code	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALGSSGTETSQVAPA
Transmembrane region	Residues 36-56
Affinity tags	Rho1D4-tag (C-terminal)
Size (excluding additional elements)	246 amino acids, 27 kDa (forms Homotrimers)
Concentration	0.4 - 0.7 mg/ml
Purity	>90%, determined via SDS-PAGE
Purification process	2-step purification
Shipping	Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function	Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.

Lab Results

TNF Eluate + DLS — **Figure 2:** Exemplary in-house SDS-Page and DLS data of TNF NativeMP™ copolymer screens. More in-depth data sets can be accessed upon project initiation.