Go to homepage
Global
USA
Cart
Buy also at
Buy also at

CLDN6 - Claudin-6

Order number: 70820
CLDN6 - Claudin-6

€7,680.00*

Prices plus VAT plus shipping costs

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Claudin 6, commonly known as CLDN6. This protein has been demonstrated to play a pivotal role in the specific obliteration of the intercellular space, a process that is integral to the maintenance of tight junctions. It functions as a receptor for the hepatitis C virus (HCV) to enter into hepatitic cells. Furthermore, it has been identified as a tumour-promoting gene, with a correlation between its expression and various forms of cancer, including ovarian, cervical, and endometrial carcinomas. Consequently, it is considered a promising target for cancer therapy.

Our CLDN6 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names CLDN6, Skullin
UniProt Number P56747
Protein class Claudin
Original host Homo sapiens
Expression system HEK293
Sequence, One-Letter Code MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYVGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 220 amino acids, 23 kDa
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function Claudin 6 is a protein has been demonstrated to play a pivotal role in the specific obliteration of the intercellular space, a process that is integral to the maintenance of tight junctions. It functions as a receptor for the hepatitis C virus (HCV) to enter into hepatitic cells. Furthermore, it has been identified as a tumour-promoting gene, with a correlation between its expression and various forms of cancer, including ovarian, cervical, and endometrial carcinomas. Consequently, it is considered a promising target for cancer therapy.
PubMed ID 9786950, 16303743, 17804490, 20375010, 21269460, 21406692, 12975309

Citations