Purified Enhanced Green Fluorescent Protein (eGFP)

Green Fluorescent Protein is a natural, autofluorescent protein from the jellyfish Aequorea victoria that is frequently used as a control protein in method development and calibration. Enhanced GFP (eGFP) is a mutated GFP with enhanced fluorescence signal and a slightly shifted excitation spectrum. Cube Biotech offers three variants of eGFP with His, GST, Rho1D4, and DYKDDDDK (also known as FLAG) tags. Please contact us for bulk inquiries, academic projects or collaboration ideas.
Expression system E. coli
Purification affinity chromatography
Provided as lyophilized from 10 mM Tris-HCl, pH 4.0
Excitation maximum 488 nm
Emission maximum 509 nm
GFP_3_SDS-PAGE
Fig. 1: Size and purity of three eGFP variants assessed by SDS-PAGE.

Protein
Protein size
Protein sequence

 
 
Red: His-tag, Grey Underlined: Spacer, Blue: GST tag, , Light Green: Rho1D4 tag, Dark Green: DYKDDDDK tag, Purple: Thrombin site, Black: eGFP, Underlined: HRV 3C (PreScission) site

His-eGFP
26 kDa

MKHHHHHHHMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK

FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKD

DGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNGHNVYITADKQKN

GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKR

DHMVLLEFVTAAGITHGMDELYKStop


GST-eGFP-Rho1D4
55.4 kDa

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYY

IDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETL

KVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKL

VCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLEVLFQGP

MRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW

PTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFE

GDTLVNRIELKGIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDG

SVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHG

MDELYKGSSGTETSQVAPAStop


GST-eGFP-DYKDDDDK
55.5 kDa

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYY

IDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETL

KVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKL

VCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLEVLFQGP

MRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW

PTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFE

GDTLVNRIELKGIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDG

SVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHG

MDELYKGSSGDYKDDDDKStop


Close window

Purified Enhanced Green Fluorescent Protein (eGFP)

Green Fluorescent Protein is a natural, autofluorescent protein from the jellyfish Aequorea victoria that is frequently used as a control protein in method development and calibration. Enhanced GFP (eGFP) is a mutated GFP with enhanced fluorescence signal and a slightly shifted excitation spectrum. Cube Biotech offers three variants of eGFP with His, GST, Rho1D4, and DYKDDDDK (also known as FLAG) tags. Please contact us for bulk inquiries, academic projects or collaboration ideas.
Expression system E. coli
Purification affinity chromatography
Provided as lyophilized from 10 mM Tris-HCl, pH 4.0
Excitation maximum 488 nm
Emission maximum 509 nm
GFP_3_SDS-PAGE
Fig. 1: Size and purity of three eGFP variants assessed by SDS-PAGE.

Protein
Protein size
Protein sequence

 
 
Red: His-tag, Grey Underlined: Spacer, Blue: GST tag, , Light Green: Rho1D4 tag, Dark Green: DYKDDDDK tag, Purple: Thrombin site, Black: eGFP, Underlined: HRV 3C (PreScission) site

His-eGFP
26 kDa

MKHHHHHHHMRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK

FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKD

DGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNGHNVYITADKQKN

GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKR

DHMVLLEFVTAAGITHGMDELYKStop


GST-eGFP-Rho1D4
55.4 kDa

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYY

IDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETL

KVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKL

VCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLEVLFQGP

MRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW

PTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFE

GDTLVNRIELKGIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDG

SVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHG

MDELYKGSSGTETSQVAPAStop


GST-eGFP-DYKDDDDK
55.5 kDa

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYY

IDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETL

KVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKL

VCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLEVLFQGP

MRSGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW

PTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFE

GDTLVNRIELKGIDFKEDGNILGHKLEYNYNGHNVYITADKQKNGIKANFKIRHNIEDG

SVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHG

MDELYKGSSGDYKDDDDKStop


Top seller
Green fluorescent protein (eGFP)
Close filters
No results were found for the filter!
GST-eGFP fusion protein, Rho1D4-tag GST-eGFP fusion protein, Rho1D4-tag
Article number: 29911
Sales price: From €214.00 *
eGFP protein, His-tag eGFP protein, His-tag
Article number: 29901
Sales price: From €190.00 *
GST-eGFP fusion protein, DYKDDDDK-tag GST-eGFP fusion protein, DYKDDDDK-tag
Article number: 29921
Sales price: From €214.00 *
Viewed