P2X purinoceptor 4
Organism: Homo sapiens (Human) | Gene names: P2RX4
Entry: Q99571
Mass: 43.369 Da
Transmembrane: 2
Subcellular location: Membrane {ECO:0000269|PubMed:10515189, ECO:0000269|PubMed:23303206, ECO:0000269|PubMed:28326637}, Multi-pass membrane protein {ECO:0000255}.
Cofactor: -
Extinction coefficient: 1.399
Isoelectric Point: 8.29
PubMed ID: 9016352, 16541075, 15489334, 10515189, 19159218, 22068874, 23303206, 28326637
Family: P2X receptor family
Function:
Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin. {ECO:0000269|PubMed:10515189, ECO:0000269|PubMed:22068874, ECO:0000269|PubMed:28326637}.
Data from experiment(s):
Involvement in disease:
-
Binding site:
-
Tissue specificity:
-
3D (X-ray crystallography):
-
Pharmaceutical use:
-
AS sequence:
MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ
Creditnotes:
The protein visualizations are generated with the help of Protter:
Omasits, U., Ahrens, C.H., Müller, S., Wollscheid, B. “Protter: interactive protein feature visualization and integration with experimental proteomic data”. Bioinformatics. 2014 Mar 15; 30(6):884-6. doi: 10.1093/bioinformatics/btt607.
IP and extinction coefficients are gathered from Protparam by ExPASy:
Gasteiger, E., Hoogland, C., Gattiker, A., Duvaud, S., Wilkins, M.R., Appel, R.D., Bairoch, A. “Protein Identification and Analysis Tools on the ExPASy Server”. (In) John M. Walker (ed): The Proteomics Protocols Handbook, Humana Press (2005). pp. 571-607
The basic knowledge is found on UniProt:
The UniProt Consortium. “UniProt: the universal protein knowledgebase in 2021”. Nucleic Acids Res. 49:D1 (2021)
Omasits, U., Ahrens, C.H., Müller, S., Wollscheid, B. “Protter: interactive protein feature visualization and integration with experimental proteomic data”. Bioinformatics. 2014 Mar 15; 30(6):884-6. doi: 10.1093/bioinformatics/btt607.
IP and extinction coefficients are gathered from Protparam by ExPASy:
Gasteiger, E., Hoogland, C., Gattiker, A., Duvaud, S., Wilkins, M.R., Appel, R.D., Bairoch, A. “Protein Identification and Analysis Tools on the ExPASy Server”. (In) John M. Walker (ed): The Proteomics Protocols Handbook, Humana Press (2005). pp. 571-607
The basic knowledge is found on UniProt:
The UniProt Consortium. “UniProt: the universal protein knowledgebase in 2021”. Nucleic Acids Res. 49:D1 (2021)