ADORA2A / ADORA2 - Adenosine receptor A2a

Order number: 70422
On Request
Product is being restocked

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Adenosine receptor A2a. This protein is an A2A adenosine receptor, and adenosine is its preferred endogenous agonist. It interacts with the G(s) and G(olf) family of G proteins, increasing cAMP levels. Thereby, the adenosine receptor is involved in pain regulation, cerebral blood flow control, and inflammation and it has been identified as a target for Parkinson's disease treatment.

Our Adenosine receptor A2a protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names ADORA2A, ADORA2
UniProt Number P29274
Protein class GPCR
Subclass Class A (Nucleotide)
Original host Homo sapiens
Expression system Trichoplusia ni
Sequence, One-Letter Code MKTIIALSYIFCLVFADYKDDDDKPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVSGSSGTETSQVAPA
Affinity tags HA signal peptide, FLAG-tag (N-terminal); Rho1D4-tag (C-terminal)
Size (excluding additional elements) 412 amino acids, 45 kDa
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function Adenosine receptor A2a is a receptor protein, and adenosine is its preferred endogenous agonist. It interacts with G(s) and G(olf), increasing cAMP levels. The adenosine receptor is involved in regulating pain, controlling blood flow in the brain and inflammation, and it has been identified as a target for Parkinson's disease treatment.
PubMed ID 15489334, 14702039, 15461802, 8670304, 1331670

Lab Results

ADORA2A Eluate + DLS
Figure 2: Exemplary in-house SDS-Page and DLS data of ADORA2A NativeMP™ copolymer screens. More in-depth data sets can be accessed upon project initiation.