ADORA2A / ADORA2 - Adenosine receptor A2a
Order number: 70422
On Request
Product is being restocked
Description
We are excited to introduce our off-the-shelf, full-length, active, and native Adenosine receptor A2a. This protein is an A2A adenosine receptor, and adenosine is its preferred endogenous agonist. It interacts with the G(s) and G(olf) family of G proteins, increasing cAMP levels. Thereby, the adenosine receptor is involved in pain regulation, cerebral blood flow control, and inflammation and it has been identified as a target for Parkinson's disease treatment.
Our Adenosine receptor A2a protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.
Our Adenosine receptor A2a protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.
Applications:
- Screening/Validation
- Biologics Development
- Structure Determination
- Small Molecule Drug Development
The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.
For more details, explore our solubilization database.

Datasheets
Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature | |
---|---|
Alternative names | ADORA2A, ADORA2 |
UniProt Number | P29274 |
Protein class | GPCR |
Subclass | Class A (Nucleotide) |
Original host | Homo sapiens |
Expression system | Trichoplusia ni |
Sequence, One-Letter Code | MKTIIALSYIFCLVFADYKDDDDKPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVSGSSGTETSQVAPA |
Affinity tags | HA signal peptide, FLAG-tag (N-terminal); Rho1D4-tag (C-terminal) |
Size (excluding additional elements) | 412 amino acids, 45 kDa |
Concentration | 0.4 - 0.7 mg/ml |
Purity | >90%, determined via SDS-PAGE |
Purification process | 2-step purification |
Shipping | Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product. |
Function | Adenosine receptor A2a is a receptor protein, and adenosine is its preferred endogenous agonist. It interacts with G(s) and G(olf), increasing cAMP levels. The adenosine receptor is involved in regulating pain, controlling blood flow in the brain and inflammation, and it has been identified as a target for Parkinson's disease treatment. |
PubMed ID | 15489334, 14702039, 15461802, 8670304, 1331670 |