CB2 - Cannabinoid receptor 2
Order number: 70461
Description
We are excited to introduce our off-the-shelf, full-length, active, and native Cannabinoid receptor 2, commonly known as CB2. Similar to CB1, this protein is a G-protein coupled receptor. CB2 has the potential as a therapeutic target for neurodegenerative conditions, e.g. Alzheimer's disease and for neuropathic pain.
Our CB2 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.
Our CB2 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.
Applications:
- Screening/Validation
- Biologics Development
- Structure Determination
- Small Molecule Drug Development
The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.
For more details, explore our solubilization database.

Datasheets
Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
| Feature | |
|---|---|
| Alternative names | CB-2, CB2, hCB2FAS, CX5, CNR2 |
| UniProt Number | P34972 |
| Protein class | GPCR |
| Subclass | Class A (Lipid) |
| Organism | Human (Homo sapiens) |
| Expression system | Trichoplusia ni |
| Sequence, One-Letter Code | MKTIIALSYIFCLVFADYKDDDDKEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDCGSSGTETSQVAPA |
| Affinity tags | HA signal peptide, FLAG-tag (N-terminal); Rho1D4-tag (C-terminal) |
| Size (excluding additional elements) | 380 amino acids, 42 kDa |
| Concentration | 0.4 - 0.7 mg/ml |
| Purity | >90%, determined via SDS-PAGE |
| Purification process | 2-step purification |
| Shipping | Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product. |
| Function | The cannabinoid receptor 2 (CB2) is a G-protein coupled receptor, which is similar to the CB1 receptor. CB2 has been identified as a potential therapeutic target for neurodegenerative conditions, including Alzheimer's disease, and for neuropathic pain. |
| PubMed ID | 7689702, 19496827, 7556170, 10400664 |