P2RX4 - P2X Purinoceptor 4
Order number: 70263
On Request
Ready to ship today
Description
We are excited to introduce our off-the-shelf, full-length, active, and native P2X Purinoceptor 4 (P2RX4) protein. P2RX4 is a ligand-gated ion channel that plays a crucial role in various physiological processes, including inflammation, pain perception, and cardiovascular function. It is an important target in research related to immune response and neurological disorders.
Our P2RX4 protein has been solubilized and stabilized using Cube Biotech's NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for a wide range of research applications.
Applications:
- Screening/Validation
- Biologics Development
- Structure Determination
- Small Molecule Drug Development
The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.
For more details, explore our solubilization database.

Datasheets
Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
| Feature | |
|---|---|
| Alternative names | P2RX4, P2X4 |
| UniProt Number | Q99571 |
| Protein class | Receptor |
| Original host | Homo sapiens |
| Expression system | HEK293 |
| Sequence, One-Letter Code | MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQGSSGTETSQVAPA |
| Affinity tags | Rho1D4-tag (C-terminal) |
| Size (excluding additional elements) | 401 amino acids, 45 kDa (forms Homotrimers) |
| Concentration | 0.4 - 0.7 mg/ml |
| Purity | >90%, determined via SDS-PAGE |
| Purification process | 2-step purification |
| Shipping | Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product. |
| Function | Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin. {ECO:0000269|PubMed:10515189, ECO:0000269|PubMed:22068874, ECO:0000269|PubMed:28326637}. |
| PubMed ID | 9016352, 16541075, 15489334, 10515189, 19159218, 22068874, 23303206, 28326637 |
Citations
Lab Results
