P2RX4 - P2X Purinoceptor 4

Order number: 70263
On Request
Ready to ship today

Description

We are excited to introduce our off-the-shelf, full-length, active, and native P2X Purinoceptor 4 (P2RX4) protein. P2RX4 is a ligand-gated ion channel that plays a crucial role in various physiological processes, including inflammation, pain perception, and cardiovascular function. It is an important target in research related to immune response and neurological disorders.

Our P2RX4 protein has been solubilized and stabilized using Cube Biotech's NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for a wide range of research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names P2RX4, P2X4
UniProt Number Q99571
Protein class Receptor
Original host Homo sapiens
Expression system HEK293
Sequence, One-Letter Code MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 401 amino acids, 45 kDa (forms Homotrimers)
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin. {ECO:0000269|PubMed:10515189, ECO:0000269|PubMed:22068874, ECO:0000269|PubMed:28326637}.
PubMed ID 9016352, 16541075, 15489334, 10515189, 19159218, 22068874, 23303206, 28326637

Lab Results

P2RX4 Eluate +DLS
Figure 2: Exemplary in-house SDS-Page and 2D classes data of P2RX4 NativeMP™ copolymer screens. More in-depth data sets can be accessed upon project initiation.