MSP1D1 "Dark", lyophilized protein

Order number: 26332
Quantity Unit price
1 - 4
€361.00*
From 5
€322.00*
Ready to ship today
Species
Quantity

Description

A weakpoint of commonly used MSP nanodiscs compared to our NativeMP technology is protein quantification through absorption measurement at 280nm. With the MSP protein having its own signal on top of the stabilized membrane protein getting to the exact protein concentration can be a hassle.

Therefore, MSP "Darks" lack any Tryptophan residues that are primarily responsible for that 280nm signal. The Tryptophans were replaced with Phenylalanines Meaning quantifications for MSP stabilized membrane proteins at 280nm is now easier than ever.

Other MSP products or related sites by Cube Biotech include:
MSP nanodisc schematic overview
Figure 1: Schematic of a MSP nanodisc. A Membrane-scaffold-protein (MSP, green) forms a disc-shaped structure with some phospholipids.

Datasheets

Feature
Available origins Human
Purity > 90% (Determined by SDS-PAGE)
Number of amino acids 201
Molecular Mass 23.2 kDA
Extinction coefficient (in water) ε280 Ext. coefficient 7450
Abs 0.1% (=1 g/l) 0.321
Buffer 20 mM TRIS pH 7.4; 100 mM NaCl; 0.5 mM EDTA
Sequence G LKLLDNFDSVTSTFSKLREQL GPVTQEFFDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKFQEEMELYRQKVE PLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLA PYSDELRQRLAARLEALKENGG ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLL PVLESFKVSFLSALEEYTKKLNTQ
Affinity tag No tag
Shipping Temperature Room Temperature
Storage of lyophilized protein -20°C for several months
Storage of reconstituted protein 2-8°C for several days

Video

Watch our video tutorial about the creation of MSP nanodiscs. It explains the whole process, starting with the initial solubilzation using detergents. The protein that was stabilized in this demonstration was Bacteriorhodopsin.

We also recommend our video guide to nanodiscs in general.

FAQ

Can I get the datasheet for the MSP1D1 protein?

What is the difference to "normal" MSP1D1?

The amino acid sequence of the MS protein was slightly changed. Among other slight mutations, all Tryptophan residues were replaced with Phenylalanines.

Is this the correct MSP product for my membrane protein?

This cannot be answered easily as every membrane protein performs differently with each nanodisc size and phospholipid. It usually requires a screening process before. Remember that membrane proteins with fewer transmembrane domains (TMD) require a smaller nanodisc, while a high number of TMDs need a larger nanodisc.

I have never worked with MSP nanodiscs before. Can you tell me more about them?

Of course! We created THIS MSP NANODISC GUIDE PAGE, for this purpose. Have a look at it!

Are there other options to stabilize membrane proteins besides MSP nanodiscs?

Yes, there are. We recommend synthetic copolymer nanodiscs greatly! Have a look at THIS GUIDE PAGE to learn more.