MSP1D1 "Dark", lyophilized protein
Order number: 26332
| Quantity | Unit price |
|---|---|
| 1 - 4 |
€361.00*
|
| From 5 |
€322.00*
|
Ready to ship today
Description
MSP1D1 “Dark” is a membrane scaffold protein (MSP) derived from apolipoprotein A-I that wraps around a phospholipid bilayer patch to form stable, water-soluble nanodiscs of approximately 9.8 nm in diameter, enabling the stabilization of membrane proteins in a defined lipid environment. Its defining feature is the replacement of all tryptophan residues with phenylalanine, resulting in a significantly reduced intrinsic fluorescence of the scaffold protein itself.
Other MSP products or related sites by Cube Biotech include:
Other MSP products or related sites by Cube Biotech include:

Datasheets
| Feature | |
|---|---|
| Available origins | Human |
| Purity | > 90% (Determined by SDS-PAGE) |
| Number of amino acids | 201 |
| Molecular Mass | 23.2 kDA |
| Extinction coefficient (in water) ε280 | Ext. coefficient 7450 Abs 0.1% (=1 g/l) 0.321 |
| Buffer | 20 mM TRIS pH 7.4; 100 mM NaCl; 0.5 mM EDTA |
| Sequence | G LKLLDNFDSVTSTFSKLREQL GPVTQEFFDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKFQEEMELYRQKVE PLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLA PYSDELRQRLAARLEALKENGG ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLL PVLESFKVSFLSALEEYTKKLNTQ |
| Affinity tag | No tag |
| Shipping Temperature | Room Temperature |
| Storage of lyophilized protein | -20°C for several months |
| Storage of reconstituted protein | 2-8°C for several days |
Citations
Video
Watch our video tutorial about the creation of MSP nanodiscs. It explains the whole process, starting with the initial solubilzation using detergents. The protein that was stabilized in this demonstration was Bacteriorhodopsin.
We also recommend our video guide to nanodiscs in general.
We also recommend our video guide to nanodiscs in general.
FAQ
Can I get the datasheet for the MSP1D1 protein?
What is the difference to "normal" MSP1D1?
The amino acid sequence of the MS protein was slightly changed. Among other slight mutations, all Tryptophan residues were replaced with Phenylalanines.
Is this the correct MSP product for my membrane protein?
This cannot be answered easily as every membrane protein performs differently with each nanodisc size and phospholipid. It usually requires a screening process before. Remember that membrane proteins with fewer transmembrane domains (TMD) require a smaller nanodisc, while a high number of TMDs need a larger nanodisc.
I have never worked with MSP nanodiscs before. Can you tell me more about them?
Of course! We created THIS MSP NANODISC GUIDE PAGE, for this purpose. Have a look at it!
Are there other options to stabilize membrane proteins besides MSP nanodiscs?
Yes, there are. We recommend synthetic copolymer nanodiscs greatly! Have a look at THIS GUIDE PAGE to learn more.