Go to homepage
Global
USA
Cart
Buy also at
Buy also at

CLDN2 - Claudin-2

Order number: 71331
CLDN2 - Claudin-2

€12,800.00*

Prices plus VAT plus shipping costs

Ready to ship today
Quantity

Description

We are excited to offer our off-the-shelf, full-length, active, and native Claudin-2 protein, also known as CLDN2, CLD2, SEMP1, and UNQ705/PRO1356. Claudin-2 is a key component of tight junctions, which regulate the permeability of epithelial cell layers. It plays different passive diffusion functions depending on the cell type it is being expressed in.

Our Claudin-2 protein is solubilized and stabilized using Cube Biotech's NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for a variety of research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names CLDN2, CLD2, UNQ705/PRO1356, SP82
UniProt Number P57739
Protein class Claudin
Original host Homo sapiens
Expression system HEK293
Sequence, One-Letter Code MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYVGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 243 amino acids, 26 kDa
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function Claudins function as major constituents of the tight junction complexes that regulate the permeability of Forms paracellular channels: polymerizes in tight junction strands with cation- and water-selective channels through the strands, conveying epithelial permeability in a process known as paracellular tight junction permeability (PubMed:20460438, PubMed:36008380). In intestinal epithelium, allows for sodium and water fluxes from the peritoneal side to the lumen of the intestine to regulate nutrient absorption and clear enteric pathogens as part of mucosal immune response (By similarity). In kidney, allows passive sodium and calcium reabsorption across proximal tubules from the lumen back to the bloodstream (By similarity). In the hepatobiliary tract, allows paracellular water and cation fluxes in the hepatic perivenous areas and biliary epithelium to generate bile flow and maintain osmotic gradients (By similarity).
PubMed ID 34964704, 37815870,31163246, 37488117, 35615069, 30349422, 24624459, 32742369, 35053454, 31086291

Citations

Lab Results