SLC6A4 - Sodium-dependent serotonin transporter
Order number: 70231
Description
We are excited to introduce our full-length, active, and native Sodium-dependent Serotonin Transporter protein, encoded by SLC6A4. This essential membrane transporter is involved in moving serotonin with one Na+ ion in exchange for one K+ ion and possibly one proton. Additionally, SLC6A4 is associated with multiple psychiatric disorders, including major depression, anxiety disorders, and substance use disorders.
Our SLC6A4 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, ideal for a variety of research applications.
Applications:
- Screening/Validation
- Biologics Development
- Structure Determination
- Small Molecule Drug Development
The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.
For more details, explore our solubilization database.

Datasheets
Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
| Feature | |
|---|---|
| Alternative names | SLC6A4, SERT, 5HTT |
| UniProt Number | P31645 |
| Protein class | SLC transporter |
| Original host | Homo sapiens |
| Expression system | HEK293 |
| Sequence, One-Letter Code | METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAVGSSGTETSQVAPA |
| Affinity tags | Rho1D4-tag (C-terminal) |
| Size (excluding additional elements) | 643 amino acids, 70 kDa (forms Dimers) |
| Concentration | 0.4 - 0.7 mg/ml |
| Purity | >90%, determined via SDS-PAGE |
| Purification process | 2-step purification |
| Shipping | Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product. |
| Function | Serotonin transporter that cotransports serotonin with one Na+ ion in exchange for one K+ ion and possibly one proton in an overall electroneutral transport cycle. Transports serotonin across the plasma membrane from the extracellular compartment to the cytosol thus limiting serotonin intercellular signaling. Essential for serotonin homeostasis in the central nervous system. |
Citations
Lab Results
