Protein CD300H

Organism: Homo sapiens (Human) | Gene names: CD300H
Entry: A0A0K2S4Q6
Mass: 21.806 Da
Transmembrane: 1
Subcellular location: [Isoform 1]: Membrane {ECO:0000255}, Single-pass type I membrane protein {ECO:0000255}., [Isoform 2]: Secreted {ECO:0000269|PubMed:26221034}.
Cofactor: -
Extinction coefficient: 1.557
Isoelectric Point: 5.37
PubMed ID: 26221034, 16625196
Family: CD300 family
Function:
May play an important role in innate immunity by mediating a signal for the production of a neutrophil chemoattractant. {ECO:0000269|PubMed:26221034}.
Data from experiment(s):
Involvement in disease:
-
Binding site:
-
Tissue specificity:
Expressed on CD16+ monocytes and myeloid dendritic cells. By contrast, is not expressed on lymphocytes or granulocytes. {ECO:0000269|PubMed:26221034}.
3D (X-ray crystallography):
-
Pharmaceutical use:
-
AS sequence:
MTQRAGAAMLPSALLLLCVPGCLTVSGPSTVMGAVGESLSVQCRYEEKYKTFNKYWCRQPCLPIWHEMVETGGSEGVVRSDQVIITDHPGDLTFTVTLENLTADDAGKYRCGIATILQEDGLSGFLPDPFFQVQVLVSSASSTENSVKTPASPTRPSQCQGSLPSSTCFLLLPLLKVPLLLSILGAILWVNRPWRTPWTES
Creditnotes:
The protein visualizations are generated with the help of Protter:
Omasits, U., Ahrens, C.H., Müller, S., Wollscheid, B. “Protter: interactive protein feature visualization and integration with experimental proteomic data”. Bioinformatics. 2014 Mar 15; 30(6):884-6. doi: 10.1093/bioinformatics/btt607.

IP and extinction coefficients are gathered from Protparam by ExPASy:
Gasteiger, E., Hoogland, C., Gattiker, A., Duvaud, S., Wilkins, M.R., Appel, R.D., Bairoch, A. “Protein Identification and Analysis Tools on the ExPASy Server”. (In) John M. Walker (ed): The Proteomics Protocols Handbook, Humana Press (2005). pp. 571-607

The basic knowledge is found on UniProt:
The UniProt Consortium. “UniProt: the universal protein knowledgebase in 2021”. Nucleic Acids Res. 49:D1 (2021)