Go to homepage
Global
USA
Cart
Buy also at
Buy also at

AMY3R (CALCR/RAMP3) - Amylin 3 receptor

Order number: 70992
AMY3R (CALCR/RAMP3) - Amylin 3 receptor
On Request
Ready to ship today
On Request

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Amylin 3 receptor, commonly known as AMY3R. This protein is a heterodimeric G protein-coupled receptor for the hormone amylin. The complex consists of the calcitonin receptor (CALCR or CTR) and the receptor activity-modifying protein 3 (RAMP3). It plays a crucial role in regulating energy balance, satiety, and blood glucose levels.

Our AMY3R protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names CALCR CT-R, CTR
Alternative names RAMP3 RAMP3
UniProt Number P30988 (CALCR), O60896 (RAMP3)
Protein class GPCR
Subclass B1 - Peptide
Original host Homo sapiens
Expression system Trichoplusia ni , Co-expression
Sequence, CALCR MKTIIALSYIFCLVFADYKDDDDKLEVLFQGPAFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIFVFFRSLGCQRVTLHKNMFLTYILNSMIIIIHLVEVVPNGELVRRDPVSCKILHFFHQYMMACNYFWMLCEGIYLHTLIVVAVFTEKQRLRWYYLLGWGFPLVPTTIHAITRAVYFNDNCWLSVETHLLYIIHGPVMAALVVNFFFLLNIVRVLVTKMRETHEAESHMYLKAVKATMILVPLLGIQFVVFPWRPSNKMLGKIYDYVMHSLIHFQGFFVATIYCFCNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSAGSSGTETSQVAPA
Sequence, RAMP3MKTIIALSYIFCLVFAHHHHHHHHHHRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL
Affinity tags CALCR HA signal peptide, DYKDDDDK-tag, TEV cleavage site (N-terminal); Rho1D4-tag (C-terminal)
Affinity tags RAMP3 HA signal peptide, His10-tag (N-terminal)
Size CALCR 478 amino acids, 55 kDa
Size RAMp3 135 amino acids, 15 kDa
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 3-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function Amylin receptor 3's function is to mediate the effects of the hormone amylin on glucose metabolism and appetite suppression, playing a significant role in regulating postprandial blood sugar levels and promoting satiety.
PubMed ID 35324283, 40828907, 26071095, 40609154, 40550231, 41109426

Citations

Lab Results