AQP9 - Aquaporin-9

Order number: 71161

€12,800.00*

Prices plus VAT plus shipping costs

Ready to ship today

Amount (µg)

Biotinylated copolymer

Enables the immobilization of your target for interaction studies (via SPR or GCI).

€500.00*

Matching empty disc

Copolymer-stabilized lipids (HEK293 or T. ni) as control (same as target preparation).

€200.00*

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Aquaporin-9, commonly known as AQP9. AQP9 is an homotetrameric transmembrane channels, with each monomer independently mediating glycerol and water transport across the plasma membrane along their osmotic gradient.

Our AQP9 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

Screening/Validation
Biologics Development
Structure Determination
Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow — **Fig. 1:** Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).

Feature
Alternative names	AQP-9
UniProt Number	O43315
Protein class	Aquaporin
Original host	Homo sapiens
Expression system	HEK293
Sequence, One-Letter Code	MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIMGSSGTETSQVAPA
Affinity tags	Rho1D4-tag (C-terminal)
Size (excluding additional elements)	295 amino acids, 33 kDa (Homodimer)
Concentration	0.4 - 0.7 mg/ml
Purity	>90%, determined via SDS-PAGE
Purification process	2-step purification
Shipping	Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function	Aquaglyceroporins form homotetrameric transmembrane channels, with each monomer independently mediating glycerol and water transport across the plasma membrane along their osmotic gradient. AQP9 is the primary route for glycerol uptake in hepatocytes, supporting hepatic gluconeogenesis (By similarity). It exhibits broad specificity and may transport various small, non-charged solutes, including carbamides, polyols, purines, and pyrimidines. AQP9 may also facilitate hepatic urea extrusion.
PubMed ID	10564231; 30420639; 35054513; 9514918; 26837049

AQP9 - Aquaporin-9

Description

Datasheets

Citations

Lab Results