CLDN7 - Claudin-7
Order number: 71341
Description
We are excited to introduce our off-the-shelf, full-length, active, and native Claudin 7, commonly known as CLDN7. This protein has been demonstrated to play a pivotal role in maintaining cell architecture and participating in cell signaling. It plays a key role in epithelial-mesenchymal transition (EMT) in which epithelial cells gain migratory and invasive properties. Furthermore, it has been identified as a tumour-promoting gene, with a correlation between its expression and various forms of cancer, including colorectal, lung, breast, ovarian, and cervical carcinomas. Consequently, it is considered a promising target for cancer therapy.
Our CLDN7 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.
Our CLDN7 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.
Applications:
- Screening/Validation
- Biologics Development
- Structure Determination
- Small Molecule Drug Development
The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.
For more details, explore our solubilization database.

Datasheets
Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
| Feature | |
|---|---|
| Alternative names | CLDN7 |
| UniProt Number | O95471 |
| Protein class | Claudin |
| Original host | Homo sapiens |
| Expression system | HEK293 |
| Sequence, One-Letter Code | MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYVGSSGTETSQVAPA |
| Affinity tags | Rho1D4-tag (C-terminal) |
| Size (excluding additional elements) | 224 amino acids, 23 kDa |
| Concentration | 0.4 - 0.7 mg/ml |
| Purity | >90%, determined via SDS-PAGE |
| Purification process | 2-step purification |
| Shipping | Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product. |
| Function | Claudin 7 is a protein has been demonstrated to play a pivotal role in the maintenance of cell architecture and cell signaling. Furthermore, it has been identified as a tumour-promoting gene, with a correlation between its expression and various forms of cancer. |
| PubMed ID | 39175074, 40650658, 35220880, 32992138, 38185042, 35053454, 29788731, 32547067, 30428910, 34815759 |