Go to homepage
Global
USA
Cart
Buy also at
Buy also at

TMEM175 - Endosomal/lysosomal proton channel TMEM175

Order number: 71761
TMEM175 - Endosomal/lysosomal proton channel TMEM175

€12,800.00*

Prices plus VAT plus shipping costs

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Endosomal/lysosomal proton channel TMEM175, commonly known as TMEM175. The physiological role of TMEM175 is centered on maintaining the electrochemical gradient required for lysosomal catabolism.  Through its influence on the lysosomal membrane potential, TMEM175 indirectly modulates the efficiency of proton import. Loss of TMEM175 leads to lysosomal instability, resulting in either luminal over-acidification or impaired acidification depending on the metabolic state of the cell.  Genetic studies have identified common variants and rare loss-of-function mutations in TMEM175 that significantly increase the risk of developing Parkinson's Disease.
 
Our TMEM175 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names Potassium channel TMEM175, Transmembrane protein 175, Q9BSA9
UniProt Number Q9BSA9
Protein class Ion channel
Original host Homo sapiens
Expression system HEK293
Localization Lysosome
Sequence, One-Letter Code MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRALYRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQQTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMFAKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLARPEHPPPAPTGQDDPQSQLLPAPCGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 517 amino acids, 57 kDa
Oligomerization Homodimer
Concentration 0.4 - 0.7 mg/mL
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function TMEM175 is a constitutively active lysosomal potassium (K+) channel that regulates organellar membrane potential and luminal pH stability, facilitating optimal enzymatic activity and autophagosome-lysosome fusion. It acts as a critical ion flux regulator to prevent lysosomal hyperpolarization during proton import by the v-ATPase.
PubMed ID 37524211, 35750034, 37390818, 39834146, 40865534

Citations

X