Go to homepage
Global
USA
Cart
Buy also at
Buy also at

SLC25A11 - Mitochondrial 2-oxoglutarate/malate carrier protein

Order number: 71691
SLC25A11 - Mitochondrial 2-oxoglutarate/malate carrier protein

€10,800.00*

Prices plus VAT plus shipping costs

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Mitochondrial 2-oxoglutarate/malate carrier protein, commonly known as SLC25A11. SLC25A11 moves 2-oxoglutarate out of the mitochondrial matrix and bringing malate in. This is crucial for the malate-aspartate shuttle and plays a huge role in gluconeogenesis and nitrogen metabolism.

Our SLC25A11 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names SLC20A4, OGCP, Mitochondrial 2-oxoglutarate/malate carrier protein, Alpha-oxoglutarate carrier, Solute carrier family 25 member 11
UniProt Number Q02978
Protein class SLC transporter
Original host Homo sapiens
Expression system HEK293
Localization Inner mitochondrial membrane
Sequence, One-Letter Code MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSGGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 327 amino acids, 35 kDa
Concentration 0.4 - 0.7 mg/mL
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function SLC25A11 serves as the essential mitochondrial 2-oxoglutarate/malate carrier, facilitating the critical antiport exchange required for the malate-aspartate shuttle and optimal oxidative phosphorylation. Integrating this high-purity recombinant protein into your workflow enables precise modulation of metabolic flux and mitochondrial membrane potential, providing a robust tool for investigating cellular bioenergetics and metabolic dysfunction.
PubMed ID 32555317, 38796028, 40242210, 36037337, 35507647

Citations

X