Go to homepage
Global
USA
Cart
Buy also at
Buy also at

SLC25A15 - Mitochondrial ornithine transporter 1

Order number: 71411
SLC25A15 - Mitochondrial ornithine transporter 1

€12,800.00*

Prices plus VAT plus shipping costs

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Mitochondrial ornithine transporter 1, commonly known as SLC25A15 or ORNT1. It is a mitochondrial inner-membrane carrier and important for the urea cycle that transports ornithine into the mitochondrial matrix in exchange for citrulline. Pathogenic variants cause hyperornithinemia– hyperammonemia–homocitrullinuria (HHH) syndrome characterized by hyperammonemia and progressive neurologic dysfunction.​
Our SLC25A15 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names SLC25A15, Mitochondrial ornithine transporter 1, Mitochondrial ornithine-citrulline antiporter, ORNT1, Solute carrier family 25 member 15, ORC1
UniProt ID Q9Y619
Protein class SLC transporter
Original host Homo sapiens
Expression system HEK293
Localization Inner mitochondrial membrane
Sequence, One-Letter Code MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAYGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 314 amino acids, 34 kDa
Concentration 0.4 - 0.7 mg/mL
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function SLC25A15 plays a key role in the urea cycle by exchanging cytosolic ornithine for mitochondrial citrulline, thereby transporting ornithine into the mitochondrial matrix. Pathogenic variants in this gene lead to hyperornithinemia–hyperammonemia–homocitrullinuria (HHH) syndrome, a disorder marked by elevated ammonia levels and progressive neurological impairment.
PubMed ID 10369256, 12807890, 22262851, 19242930

Citations

X