Go to homepage
Global
USA
Cart
Buy also at
Buy also at

SLC25A33 - Solute carrier family 25 member 33

Order number: 71701
SLC25A33 - Solute carrier family 25 member 33

€10,800.00*

Prices plus VAT plus shipping costs

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Solute carrier family 25 member 33, commonly known as SLC25A33. SLC25A33 transports pyrimidine nucleotides into and out of the mitochondria. It operates as an antiport to swap NTPs from the cytosol for NDPs from the mitochondrial matrix. It is a key driver of the pro-inflammatory macrophage response.

Our SLC25A33 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names Bone marrow stromal cell mitochondrial carrier protein (BMSC-MCP; HuBMSC-MCP), Protein PNC1
UniProt Number Q9BSK2
Protein class SLC transporter
Original host Homo sapiens
Expression system HEK293
Localization Inner mitochondrial membrane
Sequence, One-Letter Code MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAFITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 334 amino acids, 37 kDa
Concentration 0.4 - 0.7 mg/mL
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function The SLC25A33 gene encodes a mitochondrial solute carrier protein, primarily functioning as a pyrimidine nucleotide transporter that facilitates the bidirectional exchange of uracil and thymine nucleotides across the inner mitochondrial membrane to maintain organellar nucleotide pools. From a clinical perspective, dysregulation or mutations in SLC25A33 are associated with mitochondrial DNA depletion syndromes and impaired cellular proliferation, as the transporter is critical for DNA synthesis, repair, and overall metabolic homeostasis within the mitochondria.
PubMed ID 40384854, 33903774, 40734498, 25320081, 38900908

Citations

X