Go to homepage
Global
USA
Cart
Buy also at
Buy also at

SLC25A37 - Mitoferrin-1

Order number: 71791
SLC25A37 - Mitoferrin-1

€12,800.00*

Prices plus VAT plus shipping costs

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Solute carrier family 25 member 37, commonly known as Mitoferrin-1. SLC25A37 is an essential mitochondrial iron importer, shuttling ferrous iron from the intermembrane space into the mitochondrial matrix. This is relevant for heme biosynthesis and can cause anemia if misregulated or mutated.

Our SLC25A37 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names Mitochondrial iron transporter 1, Mitochondrial solute carrier protein, Solute carrier family 25 member 37, MFRN, MSCP
UniProt Number Q9NYZ2
Protein class SLC transporter
Original host Homo sapiens
Expression system HEK293
Localization Inner mitochondrial membrane
Sequence, One-Letter Code MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEHSVMYPVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAMYFACYENMKRTLNDVFHHQGNSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHRSAISCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPHRTYNPQSHIISGGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLSGMANAFRTVYQLNGLAGYFKGIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRAPYGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 351 amino acids, 38 kDa
Concentration 0.4 - 0.7 mg/mL
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function SLC25A37 (Mitoferrin-1) functions as the essential mitochondrial iron importer required for heme biosynthesis and iron-sulfur cluster assembly, particularly during red blood cell development. Therapeutically, targeting this transporter offers novel strategies to treat anemias and tissue ischemia by managing iron overload, or to combat aggressive cancers by disrupting their metabolic dependency on iron and modulating ferroptosis.
PubMed ID 39026663, 27643475, 38437058, 39512202

Citations

X