Go to homepage
Global
USA
Cart
Buy also at
Buy also at

SLC25A4 - ADP/ATP translocase 1

Order number: 70651
SLC25A4 - ADP/ATP translocase 1

€12,800.00*

Prices plus VAT plus shipping costs

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native ADP/ATP translocase 1, commonly known as SLC25A4. This essential protein is a mitochondrial ADP/ATP transporter that translocates ADP from the cytoplasm to the mitochondrial matrix and ATP from the mitochondrial matrix to the cytoplasm. It is also involved in pathways related to infectious diseases, nucleoside transport and vitamins. Mutations in SLC25A4 can affect health by causing myopathy and hypertrophic cardiomyopathy, as well as eye diseases such as external ophthalmoplegia, and it plays a role in Parkinson's disease. It is also essential for energy metabolism, making it a potential target for bioenergy supply.

Our SLC25A4 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names ADP,ATP carrier protein 1, ADP,ATP carrier protein, heart/skeletal muscle isoform T1, Adenine nucleotide translocator 1, Solute carrier family 25 member 4, AAC1, ANT1
UniProt Number P12235
Protein class SLC transporter
Original host Homo sapiens
Expression system HEK293
Localization Inner mitochondrial membrane
Sequence, One-Letter Code MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYVGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 298 amino acids, 33 kDa
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function The ADP/ATP translocase 1 is a mitochondrial ADP/ATP transporter that translocates ADP from the cytoplasm to the mitochondrial matrix and ATP from the mitochondrial matrix to the cytoplasm. It is also involved in pathways related to infectious diseases, nucleoside transport and vitamins. Mutations in SLC25A4 can affect health by causing myopathy and hypertrophic cardiomyopathy, as well as eye diseases such as external ophthalmoplegia, and it plays a role in Parkinson's disease. It is also essential for energy metabolism, making it a potential target for bioenergy supply.
PubMed ID 2823266, 2541251, 2547778, 20843780, 2829183, 16120388, 19608861

Citations

X