CD151 - CD151 antigen

Order number: 70961

€10,800.00*

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native CD151 antigen, commonly known as CD151. This essential protein is a member of the tetraspanin family, which is involved in the regulation of cellular activity, including integrin trafficking and function, as well as cell adhesion and motility. Mutations in the CD151 gene have been associated with an increased severity and reduced survival outcomes in patients diagnosed with asthma or lung cancer.

Our CD151 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative namesCD151, GP27, Membrane glycoprotein SFA-1, Platelet-endothelial tetraspan antigen 3, PETA-3, Tetraspanin
UniProt Number P48509
Protein class Tetraspanins
Original host Homo sapiens
Expression system HEK293
Sequence, One-Letter Code MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHYGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 253 amino acids, 29 kDa
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function CD151 antigen is a member of the tetraspanin family , which are involved in the regulation of cellular activity, including integrin trafficking and function, as well as cell adhesion and motility. Mutations in the CD15 gene have been associated with an increased severity and reduced survival outcomes in patients diagnosed with asthma or lung cancer.
PubMed ID 7632941, 8627808, 11181065, 11907260, 15265795, 17045834