CD9 - Tetraspanin-29

Order number: 70941

€10,800.00*

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native CD9 antigen, abbreviated CD9. This crucial protein is a member of the tetraspanin family of proteins, which are involved in various biological processes, including cell adhesion, paranodal junction function, cell motility, and tumour metastasis. In addition to these functions, CD9 plays a role in mechanisms related to fertility, such as sperm-egg fusion.

Our CD9 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names CD9, 5H9 antigen, Cell growth-inhibiting gene 2 protein , Leukocyte antigen MIC3, Motility-related protein, MRP-1, Tetraspanin-29
UniProt Number P21926
Protein class Tetraspanin
Original host Homo sapiens
Expression system HEK293
Sequence, One-Letter Code MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMVGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 228 amino acids, 25 kDa (forms Homodimers)
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function CD9 antigen is a member of the tetraspanin family of proteins, which are involved in various biological processes, including cell adhesion, paranodal junction function, cell motility, and tumour metastasis. In addition to these functions, CD9 plays a role in mechanisms related to fertility, such as sperm-egg fusion.
PubMed ID 1840589, 2037603, 1720807, 8486348, 15196249, 2358073, 8478605