Go to homepage
Global
USA
Cart
Buy also at
Buy also at

CLRN1 / USH3A - Clarin-1

Order number: 70911
CLRN1 / USH3A - Clarin-1

€12,800.00*

Prices plus VAT plus shipping costs

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Clarin-1 - commonly known as CLRN1. It is a protein that plays a role in the development and homeostasis of the inner ear and retina, and in vision and hearing in general. It is also involved in the development of synapses, which allow cell-cell communication. Mutations in CLRN1 have been associated with several diseases that affect hearing or vision, such as retinitis pigmentosa and Usher syndrome type 3a.

Our CLRN1 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names CLRN1, Usher syndrome type-3 protein, USH3A
UniProt Number P58418
Protein class Transporter
Original host Homo sapiens
Expression system HEK293
Sequence, One-Letter Code MPSQQKKIIFCMAGVFSFACALGVVTALGTPLWIKATVLCKTGALLVNASGQELDKFMGEMQYGLFHGEGVRQCGLGARPFRFSFFPDLLKAIPVSIHVNVILFSAILIVLTMVGTAFFMYNAFGKPFETLHGPLGLYLLSFISGSCGCLVMILFASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMYGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 245 amino acids, 27 kDa
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function Clarin-1 is a protein that plays a role in the development and homeostasis of the inner ear and retina, and in vision and hearing in general. It is also involved in the development of synapses, which allow cell-cell communication. Mutations in CLRN1 have been associated with several diseases that affect hearing or vision, such as retinitis pigmentosa and Usher syndrome type 3a.
PubMed ID 11524702, 12145752, 12080385, 20717163, 15521980, 18273898, 21310491

Citations

X