Go to homepage
Global
USA
Cart
Buy also at
Buy also at

TSPAN8 - Tetraspanin-8

Order number: 70931
TSPAN8 - Tetraspanin-8

€12,800.00*

Prices plus VAT plus shipping costs

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Tetraspanin-8, commonly known as TSPAN8. This essential protein has been demonstrated to play a crucial role in the mediation of signal transduction events, which are known to regulate cell development, activation and motility. Furthermore, TSPAN8 has been shown to be involved in the expression of invasive properties required for tumour progression and melanoma dissemination. Mutations of TSPAN8 have been identified as a contributing factor to a variety of medical diseases, including annular pancreas, diabetes mellitus, as well as pancreas cancer subtype 3a, which makes TSPAN8 a potential target for cancer therapy.

Our TSPAN8 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative namesTSPAN8, Tspan-8, Transmembrane 4 superfamily member 3, Tumor-associated antigen CO-029, TM4SF3
UniProt NumberP19075
Protein class Tetraspanins
Original host Homo sapiens
Expression system HEK293
Sequence, One-Letter Code MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNKGSSGTETSQVAPA
Affinity tags Rho1D4-tag (C-terminal)
Size (excluding additional elements) 250 amino acids, 27 kDa
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function Tetraspanin-8 has been demonstrated to play a crucial role in the mediation of signal transduction events, which are known to regulate cell development, activation and motility . Furthermore, TSPAN8 has been shown to be involved in the expression of invasive properties required for tumour progression and melanoma dissemination. Mutations of TSPAN8 have been identified as a contributing factor to a variety of medical diseases, including annular pancreas, diabetes mellitus, as well as pancreas cancer subtype 3a, which makes TSPAN8 a potential target for cancer therapy.
PubMed ID 2395876, 19159218, 25761241, 27180357, 34524408, 35904232, 36078095

Citations

X