CB1 - Cannabinoid receptor 1

Order number: 70451

€12,800.00*

Prices plus VAT plus shipping costs

Ready to ship today

Amount (µg)

Biotinylated copolymer

Enables the immobilization of your target for interaction studies (via SPR or GCI).

€500.00*

Matching empty disc

Copolymer-stabilized lipids (HEK293 or T. ni) as control (same as target preparation).

€200.00*

Description

We are excited to introduce our off-the-shelf, full-length, active, and native Cannabinoid receptor 1, commonly known as CNR1. This protein is a G-protein coupled receptor for endogenous cannabinoids. It is involved in various physiological responses including pain sensation, memory loss, chronic pain and anxiety.

Our CNR1 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

Screening/Validation
Biologics Development
Structure Determination
Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow — **Fig. 1:** Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).

Feature
Alternative names	CNR, CNR1, CANN6, CB-R, CB1
UniProt Number	P21554
Protein class	GPCR
Subclass	Class A (Lipid)
Organism	Human (Homo sapiens)
Expression system	Trichoplusia ni
Sequence, One-Letter Code	MKTIIALSYIFCLVFADYKDDDDKKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEALGSSGTETSQVAPA
Affinity tags	HA signal peptide, FLAG-tag (N-terminal); Rho1D4-tag (C-terminal)
Size (excluding additional elements)	492 amino acids, 55 kDa
Concentration	0.4 - 0.7 mg/ml
Purity	>90%, determined via SDS-PAGE
Purification process	2-step purification
Shipping	Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function	Cannabinoid receptor 1 is a G-protein coupled receptor for endogenous cannabinoids. It is involved in various physiological responses including pain sensation, memory loss, chronic pain and anxiety.
PubMed ID	2263478, 1718258, 7876112, 15620723, 14702039

CB1 - Cannabinoid receptor 1

Description

Datasheets

Citations