Go to homepage
Global
USA
Cart
Buy also at
Buy also at

CCRL2 - C-C chemokine receptor-like 2

Order number: 71631
CCRL2 - C-C chemokine receptor-like 2

€12,800.00*

Prices plus VAT plus shipping costs

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native C-C chemokine receptor-like 2, commonly known as CCRL2. It is a receptor for CCL19 and chemerin/RARRES2. Plays a critical role in the development of Th2 responses.

Our CCRL2 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names Chemokine receptor CCR11, Chemokine receptor X, Putative MCP-1 chemokine receptor
UniProt number O00421
Protein class GPCR
Subclass Class A (Protein)
Organism Human (Homo sapiens)
Expression system Trichoplusia ni
Sequence, One-Letter Code MKTIIALSYIFCLVFADYKDDDDKANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEVGSSGTETSQVAPA
Affinity tags HA signal peptide, DYKDDDDK (N-terminal); Rho1D4-tag (C-terminal)
Size (excluding additional elements) 364 amino acids, 42 kDa
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
FunctionCCRL2 functions as an atypical "presentation" receptor that anchors the chemoattractant chemerin to the cell surface. CCRL2 is a promising therapeutic target for modulating the microenvironment in conditions such as lung cancer, where its upregulation can enhance anti-tumor responses.
PubMed ID 40580954, 37343073, 35437825, 33363177, 33846258

Citations

X