Go to homepage
Global
USA
Cart
Buy also at
Buy also at

DRD2 - D(2) dopamine receptor

Order number: 70501
DRD2 - D(2) dopamine receptor

€12,800.00*

Prices plus VAT plus shipping costs

Ready to ship today
Quantity

Description

We are excited to introduce our off-the-shelf, full-length, active, and native D(2) dopamine receptor, commonly known as DRD2. This G-protein coupled receptor inhibits adenylyl cyclase activity and is involved in reward-mediating mesocorticolimbic pathways. DRD2 has been also associated with schizophrenia and moreover it is the main receptor for many antipsychotic drugs.

Our DRD2 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, making it ideal for various research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names DRD2, Dopamine D2 receptor
UniProt Number P14416
Protein class GPCR
Original host Homo sapiens
Expression system Trichoplusia ni
Sequence, One-Letter Code MKTIIALSYIFCLVFAMDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHCGSSGTETSQVAPA
Affinity tags HA signal peptide (N-terminal); Rho1D4-tag (C-terminal)
Size (excluding additional elements) 443 amino acids, 51 kDa
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function D(2) dopamine receptoris a G-protein coupled receptor inhibits adenylyl cyclase activity and is involved in reward-mediating mesocorticolimbic pathways. DRD2 has been also associated with schizophrenia and moreover it is the main receptor for many antipsychotic drugs.
PubMed ID 2533064, 2531656, 2138729, 2532362, 2137193, 2144985

Citations

X