P2Y purinoceptor 11 (P2RY11)

Order number: 70201

€12,800.00*

Ready to ship today
Quantity

Description

We are excited to introduce our full-length, active, and native P2Y Purinoceptor 11 protein, encoded by P2RY11. This essential protein has anti-inflammatory effects in human dendritic cells and is important for the development of anti-inflammatory / immunosuppresive therapeutics.

Our P2RY11 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, ideal for a variety of research applications.

Applications:

  • Screening/Validation
  • Biologics Development
  • Structure Determination
  • Small Molecule Drug Development

The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.

For more details, explore our solubilization database.

copolymer vs detergents workflow
Fig. 1: Detergents create environments that lack native lipids, which can compromise protein function and stability. Copolymers, enable you to see and analyze these aspects within a native environment. They facilitate studying how your target interacts with its surrounding lipids, and allow assays to be conducted at body temperature.

Datasheets

Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
Feature
Alternative names P2RY11, P2Y purinoceptor 11, P2Y11
UniProt Number Q96G91
Protein class GPCR
Subclass Class A (Nucleotide)
Original host Homo sapiens
Expression system Trichoplusia ni
Sequence, One-Letter Code MKTIIALSYIFCLVFADYKDDDDKAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRPWHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFITCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNCSVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTVAEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQGSSGTETSQVAPA
Affinity tags HA signal peptide, DYKDDDDK (N-terminal), Rho1D4-tag (C-terminal)
Size (excluding additional elements) 394 amino acids, 42 kDa
Concentration 0.4 - 0.7 mg/ml
Purity >90%, determined via SDS-PAGE
Purification process 2-step purification
Shipping Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product.
Function Receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. Not activated by UTP or UDP. Development of anti-inflammatory/immunosuppresive therapeutics, anti-inflammatory effect in human dendritic cells

Lab Results