P2Y purinoceptor 11 (P2RY11)
Order number: 70201
Description
We are excited to introduce our full-length, active, and native P2Y Purinoceptor 11 protein, encoded by P2RY11. This essential protein has anti-inflammatory effects in human dendritic cells and is important for the development of anti-inflammatory / immunosuppresive therapeutics.
Our P2RY11 protein has been solubilized and stabilized using our NativeMP™ platform, ensuring it retains its native structure and full biological activity, ideal for a variety of research applications.
Applications:
- Screening/Validation
- Biologics Development
- Structure Determination
- Small Molecule Drug Development
The protein delivered can be used for these specific applications. When ordering, please indicate which applications you intend to use the protein for in the contact form to ensure the best results.
For more details, explore our solubilization database.
Datasheets
Upon ordering, you will receive the corresponding datasheets and the Certificate of Analysis (CoA).
| Feature | |
|---|---|
| Alternative names | P2RY11, P2Y purinoceptor 11, P2Y11 |
| UniProt Number | Q96G91 |
| Protein class | GPCR |
| Subclass | Class A (Nucleotide) |
| Original host | Homo sapiens |
| Expression system | Trichoplusia ni |
| Sequence, One-Letter Code | MKTIIALSYIFCLVFADYKDDDDKAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRPWHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFITCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNCSVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTVAEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQGSSGTETSQVAPA |
| Affinity tags | HA signal peptide, DYKDDDDK (N-terminal), Rho1D4-tag (C-terminal) |
| Size (excluding additional elements) | 394 amino acids, 42 kDa |
| Concentration | 0.4 - 0.7 mg/ml |
| Purity | >90%, determined via SDS-PAGE |
| Purification process | 2-step purification |
| Shipping | Shipment is carried out on dry-ice for temperature stability to ensure the integrity of the product. |
| Function | Receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. Not activated by UTP or UDP. Development of anti-inflammatory/immunosuppresive therapeutics, anti-inflammatory effect in human dendritic cells |
Powered by Bioz
